Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.89
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Huntington's disease 76 4.566 2.3

Expression

 GO Function (1)

Gene RIF (8)

AA Sequence

MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR      1 - 70
RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN                71 - 129
//

Text Mined References (22)

PMID Year Title