Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.19
PubTator Score 10.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.500 3.8e-02
ependymoma -1.600 4.8e-02
interstitial cystitis -2.100 9.8e-03
intraductal papillary-mucinous adenoma (... 2.300 2.9e-03
intraductal papillary-mucinous carcinoma... 2.700 2.5e-02
intraductal papillary-mucinous neoplasm ... 3.300 4.2e-03
lung adenocarcinoma 1.100 1.2e-10
non-small cell lung cancer 1.070 1.8e-11
oligodendroglioma -1.500 3.7e-02
osteosarcoma 2.634 4.5e-02
pancreatic cancer 1.800 5.9e-07
psoriasis 1.100 1.0e-06
spina bifida -1.774 3.0e-02

Gene RIF (6)

AA Sequence

MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFP      1 - 70
PPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISYMLVHAGVQHILGNL     71 - 140
CMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPLRYLVGASGGVYALMGGYFMNVLVNFQEMIP    141 - 210
AFGIFRLLIIILIIVLDMGFALYRRFFVPEDGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWI    211 - 280
AIAAYLACVLFAVFFNIFLSPAN                                                   281 - 303
//

Text Mined References (16)

PMID Year Title