Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
Funding $1,960,378.41
PubMed Score 6.90
PubTator Score 14.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.532 0.000
primary pancreatic ductal adenocarcinoma 1.174 0.003
ovarian cancer 2.200 0.000
pancreatic cancer 1.100 0.005

Synonym

Accession Q9NX46 Q53G94 Q6IAB8 Q9BY47
Symbols ARH3

Gene

PANTHER Protein Class (1)

PDB

2FOZ   2FP0   2G4K  

Gene RIF (5)

PMID Text
22433848 ADP-ribosylhydrolase 3 (ARH3), not poly(ADP-ribose) glycohydrolase (PARG) isoforms, is responsible for degradation of mitochondrial matrix-associated poly(ADP-ribose).
17075046 poly(ADP-ribose) glycohydrolase ARH3 hydrolyzed O-acetyl-ADP-ribose to produce ADP-ribose in a time- and Mg(2+)-dependent reaction and thus could participate in two signaling pathways
17015823 The molecular architecture of human ARH3 constitutes the archetype of an all-alpha-helical protein fold and suggests reversibility mechanisms of protein ADP-ribosylation.
16511307 cloning, recombinant production, purification and crystallization of ARH3 consisting of 347 amino-acid residues
16278211 ARH3 has poly(ADP-ribose) glycohydrolase activity but is structurally unrelated to poly(ADP-ribose) glycohydrolase

AA Sequence

MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT      1 - 70
EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPAR     71 - 140
AQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSEH    141 - 210
FLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTA    211 - 280
IYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETD    281 - 350
ILAQSLHRVFQKS                                                             351 - 363
//

Publication (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22433848 2012 ADP-ribosylhydrolase 3 (ARH3), not poly(ADP-ribose) glycohydrolase (PARG) isoforms, is responsible for degradation of mitochondrial matrix-associated poly(ADP-ribose).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21892188 2011 The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991898 2008 Functional localization of two poly(ADP-ribose)-degrading enzymes to the mitochondrial matrix.
17075046 2006 The 39-kDa poly(ADP-ribose) glycohydrolase ARH3 hydrolyzes O-acetyl-ADP-ribose, a product of the Sir2 family of acetyl-histone deacetylases.
17015823 2006 The structure of human ADP-ribosylhydrolase 3 (ARH3) provides insights into the reversibility of protein ADP-ribosylation.
More...