Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.60
PubTator Score 14.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-06
ovarian cancer 8520 4.3e-05
primary pancreatic ductal adenocarcinoma 1109 3.4e-03
pancreatic cancer 2398 5.1e-03
Disease Target Count Z-score Confidence
Cholera 34 3.103 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.532 1.6e-06
ovarian cancer 2.200 4.3e-05
pancreatic cancer 1.100 5.1e-03
primary pancreatic ductal adenocarcinoma 1.174 3.4e-03

Gene RIF (5)

AA Sequence

MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT      1 - 70
EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPAR     71 - 140
AQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSEH    141 - 210
FLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTA    211 - 280
IYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETD    281 - 350
ILAQSLHRVFQKS                                                             351 - 363
//

Text Mined References (18)

PMID Year Title