Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.36
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 3.3e-03
Astrocytoma, Pilocytic -1.100 2.3e-02
colon cancer -1.200 2.4e-03
interstitial cystitis -1.400 3.8e-02
lung cancer 2.900 5.5e-05
medulloblastoma, large-cell 1.400 9.1e-05
sonic hedgehog group medulloblastoma 1.300 3.2e-02
subependymal giant cell astrocytoma 1.343 4.0e-02
urothelial carcinoma -1.600 2.9e-02

Gene RIF (6)

AA Sequence

MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLL      1 - 70
KVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCP     71 - 140
SNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKE    141 - 210
KLRRERIKYCCEQLRTLLPYVKGRKNDAASVLEATVDYVKYIREKISPAVMAQITEALQSNMRFCKKQQT    211 - 280
PIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSASENAIGDPYKT    281 - 350
HISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRHCTSGLGQTCTTHPNCLQ    351 - 420
QFWAY                                                                     421 - 425
//

Text Mined References (18)

PMID Year Title