Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.62
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease -1.100 1.9e-02
astrocytic glioma 1.500 1.4e-02
ependymoma 1.700 6.1e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
medulloblastoma, large-cell -1.100 3.5e-05
non primary Sjogren syndrome sicca 1.200 2.9e-02
oligodendroglioma 1.700 3.7e-03
osteosarcoma 1.769 2.1e-06
ovarian cancer -1.600 2.2e-05
pancreatic ductal adenocarcinoma liver m... 1.760 2.7e-03
Pick disease -1.300 1.2e-05

Synonym

Accession Q9NX40 C9K030 G8JLN7 Q9BZE8
Symbols OCIA
ASRIJ
TPA018

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH      1 - 70
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG     71 - 140
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY    141 - 210
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE                                       211 - 245
//

Text Mined References (26)

PMID Year Title