Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.12
PubTator Score 10.50

Knowledge Summary


No data available


  Differential Expression (11)

Gene RIF (7)

23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein OCIA domain containing 1 (OCIAD1) in cells
22726067 Like OCIAD1, OCIAD2 is a cancer-related protein and its expression level increases during the course of malignant progression and is thought to be a very useful marker for evaluating the malignancy of ovarian mucinous tumors.
22081784 OCIAD1 is a potential biomarker of thyroid carcinoma but had no significant additive effect on the risk of distant metastasis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20515946 This is the first study to indicate that OCIAD1 is a key player in generating ovarian cancer recurrence.
19460752 Knockdown of OCIA domain containing 1 (OCIAD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18328549 Over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibility of OCIAD1's role in tumor metastasis.

AA Sequence

EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE                                       211 - 245

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22726067 2012 Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.
22081784 2012 Expression of NCAM and OCIAD1 in well-differentiated thyroid carcinoma: correlation with the risk of distant metastasis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20515946 2010 Role of the 18:1 lysophosphatidic acid-ovarian cancer immunoreactive antigen domain containing 1 (OCIAD1)-integrin axis in generating late-stage ovarian cancer.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.