Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
Multiple myeloma 1.050 0.026
malignant mesothelioma 1.800 0.000
medulloblastoma, large-cell -1.100 0.004
tuberculosis and treatment for 6 months 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9NX31 B2RCK4 O95912 Q9NZ84 Q9P0R8
Symbols Osr1
Perit1
HSPC207
C20orf111
dJ1183I21.1

Gene

 Compartment GO Term (1)

AA Sequence

MKSEAKDGEEESLQTAFKKLRVDASGSVASLSVGEGTGVRAPVRTATDDTKPKTTCASKDSWHGSTRKSS      1 - 70
RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSGLGISSPKEFSAGESSTSLDA     71 - 140
NHTGAVVEPLRTSVPRLPSESKKEDSSDATQVPQASLKASDLSDFQSVSKLNQGKPCTCIGKECQCKRWH    141 - 210
DMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIP    211 - 280
KKMSHMAEMMYT                                                              281 - 292
//

Publication (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17148688 2007 Cardiac myocyte gene expression profiling during H2O2-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.