Property Summary

NCBI Gene PubMed Count 27
Grant Count 21
R01 Count 6
Funding $4,920,125.54
PubMed Score 27.81
PubTator Score 19.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.972 0.000
psoriasis 1.700 0.000
lung cancer 2.300 0.001
non primary Sjogren syndrome sicca 1.100 0.047
ovarian cancer 2.200 0.000

Gene RIF (6)

PMID Text
25906515 Indian aplastic anemia patients did not have NHP2 mutations.
22944692 Positional proteomics analysis identifies the cleavage of human NHP2 ribonucleoprotein homolog (yeast) (NHP2) at amino acid residues 27-28 by the HIV-1 protease
20008900 Effects of dyskeratosis congenita mutations in NHP2 on assembly of H/ACA pre-RNPs
18523010 The analysis of two other proteins, NHP2 and GAR1, that together with dyskerin and NOP10 are key components of telomerase and small nucleolar ribonucleoprotein (snoRNP) complexes, is described.
15889794 NOLA2 expression in patients with squamous cell lung cancer increased by 70% which makes it a highly informative marker of squamous cell lung cancer
15814878 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKF      1 - 70
VNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYD     71 - 140
ECLEEVQSLPLPL                                                             141 - 153
//

Publication (37)

PMID Year Title
25906515 2014 Detection of mutations in TERT, the genes for telomerase reverse transcriptase, in Indian patients of aplastic anaemia: a pilot study.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...