Property Summary

Ligand Count 1
NCBI Gene PubMed Count 18
PubMed Score 150.21
PubTator Score 34.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.063 3.6e-04
ovarian cancer 2.100 5.0e-06

Gene RIF (6)

AA Sequence

MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKN      1 - 70
PDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESN     71 - 140
CFDPSKIQLPEDE                                                             141 - 153
//

Text Mined References (22)

PMID Year Title