Property Summary

NCBI Gene PubMed Count 64
PubMed Score 150.32
PubTator Score 71.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid arthritis 2.300 4.8e-02
active Crohn's disease 1.355 3.8e-02
active ulcerative colitis 3.315 2.9e-03
acute quadriplegic myopathy 1.280 1.1e-02
astrocytoma 1.800 8.0e-23
chronic lymphosyte leukemia -1.600 7.6e-07
colon cancer 1.300 1.2e-02
cystic fibrosis 1.166 3.2e-04
Down syndrome 1.600 2.9e-02
ependymoma 2.200 3.5e-02
glioblastoma 1.400 2.4e-02
intraductal papillary-mucinous adenoma (... -2.300 3.2e-04
intraductal papillary-mucinous carcinoma... -2.500 1.2e-03
juvenile dermatomyositis 1.044 6.3e-05
lung adenocarcinoma -1.100 1.4e-03
non-small cell lung cancer 1.206 3.0e-10
oligodendroglioma 1.800 5.6e-20
ovarian cancer 3.400 3.7e-07
psoriasis -1.400 1.5e-04
tuberculosis -1.700 3.6e-06

 GO Function (1)

 GWAS Trait (1)

Gene RIF (50)

AA Sequence

MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDT      1 - 70
AYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPC     71 - 140
GLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTL    141 - 210
STGFRVIKKKLYSSEQLLIEEC                                                    211 - 232
//

Text Mined References (71)

PMID Year Title