Property Summary

NCBI Gene PubMed Count 56
Grant Count 65
R01 Count 40
Funding $5,317,365.8
PubMed Score 134.66
PubTator Score 71.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q9NX09 Q9H0S3
Symbols Dig2
REDD1
REDD-1

Gene

PDB

3LQ9  

Gene RIF (43)

PMID Text
26968249 C/EBPbeta promotes autophagy in PC3 cells by augmenting REDD1 expression.
26487002 These data highlight the central role of REDD1 in regulating both protein synthesis and autophagy in skeletal muscle during sepsis.
26269521 Findings from this study propose a REDD1-regulated mechanism in T2D skeletal muscle that may contribute to whole body insulin resistance and may be a target to improve insulin action in insulin-resistant individuals.
25504525 REDD1 knockout (KO) mice, all skin compartments, epidermal stem, and progenitor cells were protected from atrophic effects of glucocorticoids.
25337238 REDD1 and p-AKT over-expression may serve as a prognostic biomarker in ovarian cancer, but KRAS mutations and REDD1 protein over-expression were not correlated in OC.
25255219 MiR-630 reduced apoptosis by downregulating several apoptotic modulators, PARP3, DDIT4, and EP300.
25147182 analysis of ubiquitin-mediated proteolysis of DNA damage-inducible transcript 4 (DDIT4) by the E3 ligase HUWE1
25058423 Caspase 3 cleaved REDD1 during apoptotic activation.
25056877 the results demonstrate that REDD1 acts not only as a repressor of mTORC1 but also as a constant modulator of the phosphorylation of Akt in response to growth factors and nutrients.
24728411 these postmortem and preclinical findings identify REDD1 as a critical mediator of the atrophy of neurons and depressive behavior caused by chronic stress exposure
More...

AA Sequence

MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDT      1 - 70
AYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPC     71 - 140
GLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTL    141 - 210
STGFRVIKKKLYSSEQLLIEEC                                                    211 - 232
//

Text Mined References (63)

PMID Year Title
26968249 2016 C/EBP? regulates sensitivity to bortezomib in prostate cancer cells by inducing REDD1 and autophagosome-lysosome fusion.
26487002 2015 Disruption of REDD1 gene ameliorates sepsis-induced decrease in mTORC1 signaling but has divergent effects on proteolytic signaling in skeletal muscle.
26269521 2015 Aberrant REDD1-mTORC1 responses to insulin in skeletal muscle from Type 2 diabetics.
25504525 2014 REDD1 functions at the crossroads between the therapeutic and adverse effects of topical glucocorticoids.
25337238 2014 REDD1 and p-AKT over-expression may predict poor prognosis in ovarian cancer.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
25147182 2014 Quantitative Lys-?-Gly-Gly (diGly) proteomics coupled with inducible RNAi reveals ubiquitin-mediated proteolysis of DNA damage-inducible transcript 4 (DDIT4) by the E3 ligase HUWE1.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
25058423 2014 A new posttranslational regulation of REDD1/DDIT4 through cleavage by caspase 3 modifies its cellular function.
25056877 2014 REDD1 enhances protein phosphatase 2A-mediated dephosphorylation of Akt to repress mTORC1 signaling.
More...