Property Summary

NCBI Gene PubMed Count 7
Grant Count 14
R01 Count 10
Funding $762,806.7
PubMed Score 41.58
PubTator Score 3.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -2.022 0.000
group 3 medulloblastoma 1.200 0.005

Gene RIF (1)

PMID Text
16508009 our studies delineating the multiple, coordinated protein-nucleic acid interactions between SECp43 and the selenoprotein cotranslational factors.

AA Sequence

MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPL      1 - 70
PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYG     71 - 140
FVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYD    141 - 210
QNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVS    211 - 280
SEIPAMM                                                                   281 - 287
//

Publication (9)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16508009 2006 Supramolecular complexes mediate selenocysteine incorporation in vivo.
16230358 2005 Evidence for direct roles of two additional factors, SECp43 and soluble liver antigen, in the selenoprotein synthesis machinery.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10606267 1999 Identification of a protein component of a mammalian tRNA(Sec) complex implicated in the decoding of UGA as selenocysteine.