Property Summary

NCBI Gene PubMed Count 8
PubMed Score 43.99
PubTator Score 3.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.3e-05
psoriasis 6694 3.4e-05
group 3 medulloblastoma 4104 5.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 5.3e-03
osteosarcoma -2.022 3.3e-05
psoriasis -2.200 3.4e-05

Synonym

Accession Q9NX07 Q86SU7
Symbols SECP43
PRO1902
TRSPAP1

Gene

PDB

2DHG   2DIV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPL      1 - 70
PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYG     71 - 140
FVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYD    141 - 210
QNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVS    211 - 280
SEIPAMM                                                                   281 - 287
//

Text Mined References (10)

PMID Year Title