Property Summary

NCBI Gene PubMed Count 35
Grant Count 19
R01 Count 19
Funding $2,342,313.03
PubMed Score 65.61
PubTator Score 51.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.600 0.000
lung cancer 2.700 0.001
cystic fibrosis 3.300 0.000
type I diabetes mellitus -1.170 0.034
facioscapulohumeral dystrophy 2.100 0.020

Gene RIF (23)

PMID Text
26253076 genetic polymorphism is associated with chronic pancreatitis
25376457 No disease-causing mutations were identified in NLRP2, NLRP7 and KHDC3L in cohorts of unexplained infertility and recurrent pregnancy loss.
24871464 Findings suggest that NLR family pyrin domain containing 2 (NLRP2P) is a processed pseudogene that regulates NF-kappaB RelA/p65 activity and thus represents the newest member of the POP family, pyrin-only protein 4 (POP4; NLRP4).
24754275 This study indicates that polymorphisms in SPARC and NLRP2 are related to rheumatoid arthritis susceptibility in a Chinese Han population.
23644288 single nucleotide polymorphisms in NALP2 gene is associated with arsenic induced skin lesions, peripheral neuropathy, eye problem and respiratory diseases.
23625868 The results of this study suggest that the astrocytic NLRP2 inflammasome is an important component of the CNS inflammatory response
23360675 There is a significant association of a tag single-nucleotide polymorphism (SNP) of NLRP7 (rs26949) with idiopathic recurrent miscarriage
22909446 Observations suggest that although NLRP7 and C6orf221 mutations are related to diploid biparental FRHMs, neither of these genes, nor NLRP2, are related to diploid HMs with biparental contributions to the molar genome.
21976665 POP2 acts as a regulator of inflammatory signals and exerts its two known functions through distinct modalities employed by its first alpha-helix
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEM      1 - 70
ASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGN     71 - 140
VICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVV    141 - 210
LYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQA    211 - 280
RKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE    281 - 350
PIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP    351 - 420
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILR    421 - 490
QDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGL    491 - 560
ANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISL    561 - 630
HLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKD    631 - 700
LMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDM    701 - 770
FPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC    771 - 840
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDIT    841 - 910
SDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSC    911 - 980
NQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHP    981 - 1050
WAERPSSHDFMI                                                             1051 - 1062
//

Text Mined References (40)

PMID Year Title
26253076 2015 The Q705K and F359L Single-Nucleotide Polymorphisms of NOD-Like Receptor Signaling Pathway: Association with Chronic Pancreatitis, Pancreatic Cancer, and Periodontitis.
25376457 2015 No evidence for mutations in NLRP7, NLRP2 or KHDC3L in women with unexplained recurrent pregnancy loss or infertility.
24871464 2014 The CLRX.1/NOD24 (NLRP2P) pseudogene codes a functional negative regulator of NF-?B, pyrin-only protein 4.
24754275 2015 Association of polymorphisms in SPARC and NLRP2 genes with rheumatoid arthritis in a Chinese Han population.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23644288 2013 Association of NALP2 polymorphism with arsenic induced skin lesions and other health effects.
23625868 2013 Human astrocytes express a novel NLRP2 inflammasome.
23360675 2013 A genetic association study of NLRP2 and NLRP7 genes in idiopathic recurrent miscarriage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...