Property Summary

NCBI Gene PubMed Count 19
PubMed Score 154.64
PubTator Score 19.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5792 3.2e-04
medulloblastoma, large-cell 6241 4.8e-04
Disease Target Count Z-score Confidence
Vaginal discharge 9 4.096 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma 1.100 3.2e-04
medulloblastoma, large-cell 1.200 4.8e-04

Synonym

Accession Q9NX01 D3DWS6
Symbols DLP
Dim2

Gene

PDB

1XBS   3GIX   4IN0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT      1 - 70
QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP     71 - 140
KYDLLYQDI                                                                 141 - 149
//

Text Mined References (20)

PMID Year Title