Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.23
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 1.98759110040659E-5
medulloblastoma, large-cell 6234 5.44063881245635E-5
atypical teratoid / rhabdoid tumor 4369 7.11113204761591E-5
adult high grade glioma 2148 2.80573565813443E-4
medulloblastoma 1524 0.00160437356600243
pilocytic astrocytoma 3086 0.00228105533037699
primitive neuroectodermal tumor 3031 0.00655493621550749
astrocytic glioma 2241 0.0147315361915708
ependymoma 2514 0.0162436737199665
oligodendroglioma 2849 0.0350073580994381

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 0.015
ependymoma -2.200 0.016
oligodendroglioma -1.500 0.035
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.300 0.007
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.200 0.002

Synonym

Accession Q9NX00 Q9BU41
Symbols

Gene

  Ortholog (7)

Gene RIF (1)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with transmembrane protein 160 (TMEM160) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETA      1 - 70
FLSWFRNGLLASGIGVISFMQSDMGREAAYGFFLLGGLCVVWGSASYAVGLAALRGPMQLTLGGAAVGAG     71 - 140
AVLAASLLWACAVGLYMGQLELDVELVPEDDGTASAEGPDEAGRPPPE                          141 - 188
//

Text Mined References (8)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.