Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.21
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.174 1.0e-02
colon cancer 1.100 3.5e-02
group 3 medulloblastoma 1.500 1.2e-05
medulloblastoma, large-cell 1.100 2.8e-02
Multiple myeloma 1.279 5.5e-04
osteosarcoma 1.180 9.3e-05
ovarian cancer 2.500 3.5e-08
Pick disease -1.400 1.0e-05
progressive supranuclear palsy -1.100 1.2e-02

Gene RIF (1)

AA Sequence

MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPP      1 - 70
LLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLT     71 - 140
EQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVIIFEGIMA    141 - 210
FADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVP    211 - 280
RGSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEF    281 - 350
IFYSKRLMRLLIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG    351 - 420
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMG    421 - 490
VHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSDEEEVAYTG                491 - 548
//

Text Mined References (17)

PMID Year Title