Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $168,750
PubMed Score 1.54
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.174 0.010
Multiple myeloma 1.279 0.001
osteosarcoma 1.180 0.000
medulloblastoma, large-cell 1.200 0.000
colon cancer 1.100 0.035
group 3 medulloblastoma 1.500 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.012
ovarian cancer 2.500 0.000

Synonym

Accession Q9NWZ5 B7Z8N2 Q5JWV0 Q70AQ5 Q8N524 Q9H3Z2
Symbols UCK1L
URKL1

Gene

PANTHER Protein Class (3)

 Grant Application (1)

Gene RIF (1)

PMID Text
19653100 These results indicate a role for UCKL-1 in tumor cell survival.

AA Sequence

MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPP      1 - 70
LLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLT     71 - 140
EQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVIIFEGIMA    141 - 210
FADKTLLELLDMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVP    211 - 280
RGSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEF    281 - 350
IFYSKRLMRLLIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG    351 - 420
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMG    421 - 490
VHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSDEEEVAYTG                491 - 548
//

Publication (17)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19653100 2009 Downregulation of uridine-cytidine kinase like-1 decreases proliferation and enhances tumor susceptibility to lysis by apoptotic agents and natural killer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16709802 2006 NK lytic-associated molecule, involved in NK cytotoxic function, is an E3 ligase.
More...