Property Summary

Ligand Count 147
NCBI Gene PubMed Count 116
PubMed Score 202.19
PubTator Score 133.07

Knowledge Summary

Patent (19,575)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 4.3e-06

Protein-protein Interaction (3)

PDB (28)

Gene RIF (93)

AA Sequence

MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL      1 - 70
LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN     71 - 140
LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV    141 - 210
AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT    211 - 280
PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG    281 - 350
TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND    351 - 420
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS                                  421 - 460
//

Text Mined References (133)

PMID Year Title