Property Summary

NCBI Gene PubMed Count 106
PubMed Score 182.38
PubTator Score 133.07

Knowledge Summary

Patent (19,575)


  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 0.000


Accession Q9NWZ3 Q69FE1 Q8TDF7 Q9Y589 IRAK-4
Symbols IPD1



2NRU   2NRY   2O8Y   2OIB   2OIC   2OID   3MOP   4RMZ   4U97   4U9A   4XS2   4Y73   4YO6   4YP8   4ZTL   4ZTM   4ZTN  

  Ortholog (11)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (85)

26698383 Siblings with compound heterozygosity for two mutations: a frameshift mutation at one allele (c.1146delT (p.G383fs)), and an in-frame duplication variant at the other (c.255_260dup6 (p.D86_L87dup)) leading to fatal pneumococcal meningitis is described.
26472314 missense mutation results in immunological deficiency phenotype
26075815 This is the first study to show an association between single nucleotide polymorphisms in IRAK1, IRAK4 and MyD88, and the presence of severe invasive pneumococcal disease.
25922567 Src, Syk, IRAK1, and IRAK4 have roles in anti-inflammatory responses mediated by dietary flavonoid Kaempferol
25886387 findings suggest that rare, functional variants in MYD88, IRAK4 or IKBKG do not significantly contribute to IPD susceptibility in adults at the population level
25479567 Studies indicate that interleukin-1 receptor-associated kinase 4 protein (IRAK4), a serine/threonine kinase, plays a key role in both inflammation and oncology diseases.
25344726 delineation of the latter responses identified a narrow repertoire of transcriptional programs affected by loss of MyD88 function or IRAK4 function
25320238 by bolstering the IgM(+)IgD(+)CD27(+) B-cell subset, IRAK-4 and MyD88 promote optimal T-independent IgM antibody responses against bacteria in humans.
25201411 Data show that dimerization is crucial for IRAK4 autophosphorylation in vitro and ligand dependent signaling in cells.
24690905 High mRNA levels of IRAK1 and IRAK4 correlated with VKH disease activity.

AA Sequence

ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS                                  421 - 460

Text Mined References (123)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26698383 2016 IRAK-4 deficiency as a cause for familial fatal invasive infection by Streptococcus pneumoniae.
26472314 2015 PID in Disguise: Molecular Diagnosis of IRAK-4 Deficiency in an Adult Previously Misdiagnosed With Autosomal Dominant Hyper IgE Syndrome.
26075815 2015 Association of Polymorphisms in IRAK1, IRAK4 and MyD88, and Severe Invasive Pneumococcal Disease.
25922567 2015 The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.
25886387 2015 Rare variants in MYD88, IRAK4 and IKBKG and susceptibility to invasive pneumococcal disease: a population-based case-control study.
25479567 2015 Recent advances in the discovery of small molecule inhibitors of interleukin-1 receptor-associated kinase 4 (IRAK4) as a therapeutic target for inflammation and oncology disorders.
25344726 2014 A narrow repertoire of transcriptional modules responsive to pyogenic bacteria is impaired in patients carrying loss-of-function mutations in MYD88 or IRAK4.
25320238 2014 IRAK-4 and MyD88 deficiencies impair IgM responses against T-independent bacterial antigens.
25201411 2014 IRAK4 dimerization and trans-autophosphorylation are induced by Myddosome assembly.