Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.69
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Fibrosis 44 0.0 0.0
Kidney Diseases 114 0.0 0.0
Disease Target Count Z-score Confidence
Cerebellar Ataxia 304 3.055 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.3e-04
medulloblastoma, large-cell 1.600 3.1e-04
osteosarcoma -1.159 2.4e-04
ovarian cancer -1.300 2.3e-05
sonic hedgehog group medulloblastoma 1.400 3.2e-06

Gene RIF (7)

AA Sequence

MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN      1 - 70
FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY     71 - 140
WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG    141 - 210
TLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD    211 - 280
IIGDAFWKEHPEILDEDS                                                        281 - 298
//

Text Mined References (19)

PMID Year Title