Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.69
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Fibrosis 40
Kidney Diseases 86
Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 3.00122595972862E-7
sonic hedgehog group medulloblastoma 1482 3.19859448883768E-6
ovarian cancer 8492 2.33683473368153E-5
osteosarcoma 7933 2.35391857022253E-4
medulloblastoma, large-cell 6234 3.11077501727828E-4
Disease Target Count Z-score Confidence
Cerebellar Ataxia 72 3.057 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.159 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9NWX6 D3DQJ5 Q53G12 Q7L5R3 Q9H0S2
Symbols ICF45
IHG-1
hTHG1

Gene

PDB

3OTB   3OTC   3OTD   3OTE  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25008184 IHG-1 is a novel regulator of both mitochondrial dynamics and bioenergetic function and contributes to cell survival following oxidant stress. Increased IHG-1 expression may contribute to pathogenesis of diabetic kidney disease.
22136300 The high-resolution crystal structure of human Thg1 reveals remarkable structural similarity between canonical DNA/RNA polymerases and eukaryotic Thg1.
21784897 IHG-1 increases mitochondrial biogenesis by promoting PGC-1alpha-dependent processes, potentially contributing to the pathogenesis of renal fibrosis
21078997 The catalytic domain of Thg1 shares both a common architecture and a two-metal ion-dependent mechanism with canonical 5'-3' DNA polymerases.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18508967 induced in high glucose-1 (IHG-1)which increases in diabetic nephropathy, may enhance the actions of TGF-beta1 and contribute to the development of tubulointerstitial fibrosis
15459185 ICF45 is a highly conserved novel protein, which is expressed in a cell cycle-dependent manner and seemed to be involved in cell cycle progression and cell proliferation

AA Sequence

MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN      1 - 70
FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY     71 - 140
WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG    141 - 210
TLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD    211 - 280
IIGDAFWKEHPEILDEDS                                                        281 - 298
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25008184 2014 IHG-1 increases mitochondrial fusion and bioenergetic function.
23844012 2013 Structural studies of a bacterial tRNA(HIS) guanylyltransferase (Thg1)-like protein, with nucleotide in the activation and nucleotidyl transfer sites.
22136300 2012 Kinetic analysis of 3'-5' nucleotide addition catalyzed by eukaryotic tRNA(His) guanylyltransferase.
21784897 2011 IHG-1 promotes mitochondrial biogenesis by stabilizing PGC-1?.
21078997 2010 Crystal structure of a reverse polymerase.
21059936 2010 tRNA(His) guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18508967 2008 IHG-1 amplifies TGF-beta1 signaling and is increased in renal fibrosis.
More...