Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.65
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.047
interstitial cystitis 2.600 0.018
cystic fibrosis 1.100 0.030
nasopharyngeal carcinoma -1.500 0.000
ovarian cancer 1.100 0.000

Gene RIF (5)

PMID Text
22605381 Data show that acyl-modified forms of HRAS-like tumor suppressors HRASLS2 and HRASLS3 mimicking lipolytic activity of lecithin retinol acyltransferase LRAT.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19615464 The tumor suppressors TIG3, HRASLS2 and H-rev107 are involved in the phospholipid metabolism with different physiological roles.
18163183 HRASLS2 protein suppressed growth and RAS activities of cancer cells, and the C-terminal hydrophobic domain appeared to be indispensable for both activities.

AA Sequence

MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVAG      1 - 70
GDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQVTGAVTTVGVA     71 - 140
AGLLAAASLVGILLARSKRERQ                                                    141 - 162
//

Publication (6)

PMID Year Title
22605381 2012 Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19615464 2009 Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes.
18163183 2008 Cloning and functional characterization of the HRASLS2 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.