Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.65
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Poland syndrome 14 5.611 2.8

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.7e-02
cystic fibrosis 1.100 3.0e-02
interstitial cystitis 2.600 1.8e-02
nasopharyngeal carcinoma -1.500 1.3e-07
ovarian cancer 1.100 4.2e-04

Gene RIF (5)

AA Sequence

MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVAG      1 - 70
GDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQVTGAVTTVGVA     71 - 140
AGLLAAASLVGILLARSKRERQ                                                    141 - 162
//

Text Mined References (6)

PMID Year Title