Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.06
PubTator Score 3.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 6.47228669201399E-9
medulloblastoma, large-cell 6234 3.59830851533428E-6
atypical teratoid / rhabdoid tumor 4369 6.14793989771916E-6
cystic fibrosis 1670 1.78848417174167E-5
lung cancer 4473 2.63517573897132E-5
pituitary cancer 1972 5.65701753815902E-5
ovarian cancer 8492 1.78093041778004E-4
primitive neuroectodermal tumor 3031 9.44411442782519E-4
medulloblastoma 1524 0.00300320101780951
glioblastoma 5572 0.00962249240180653
pancreatic cancer 2300 0.0179918523434619
primary pancreatic ductal adenocarcinoma 1271 0.0203879679252897
astrocytic glioma 2241 0.0295757327247421
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0332533717646572
esophageal adenocarcinoma 737 0.0382055779214775

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -3.600 0.000
astrocytic glioma -1.500 0.030
esophageal adenocarcinoma -1.400 0.038
medulloblastoma -1.600 0.003
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.100 0.010
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.400 0.001
primary pancreatic ductal adenocarcinoma -1.441 0.020
intraductal papillary-mucinous neoplasm ... -1.100 0.033
lung cancer -2.200 0.000
cystic fibrosis -1.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer -1.100 0.000
pancreatic cancer -1.400 0.018

Synonym

Accession Q9NWW6 Q5W124 Q8N430 NRK 1
Symbols NRK1
C9orf95
bA235O14.2

Gene

PANTHER Protein Class (2)

PDB

2P0E   2QG6   2QL6   2QSY   2QSZ   2QT0   2QT1  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
17698003 Crystal structure of NRK1 is reported.

AA Sequence

MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI      1 - 70
SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP     71 - 140
GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA               141 - 199
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17914902 2007 Nicotinamide riboside kinase structures reveal new pathways to NAD+.
17698003 2007 Crystal structure of human nicotinamide riboside kinase.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15137942 2004 Discoveries of nicotinamide riboside as a nutrient and conserved NRK genes establish a Preiss-Handler independent route to NAD+ in fungi and humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...