Property Summary

NCBI Gene PubMed Count 37
PubMed Score 0.00
PubTator Score 67.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
pituitary cancer 1972 1.3e-05
medulloblastoma, large-cell 6241 5.6e-05
osteosarcoma 7950 1.7e-03
Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 6 1 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Blindness 88 3.469 1.7
Visual pathway disease 4 3.282 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 5.6e-05
osteosarcoma -1.014 1.7e-03
pituitary cancer 1.300 1.3e-05

Gene RIF (21)

AA Sequence

MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFP      1 - 70
LEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFS     71 - 140
GYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTASKAESLIPGPA    141 - 210
LLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFLFSSFALTLLLVALWVAWL    211 - 280
WNDPVLRKKYPGVIYVPEPWAFYTLHVSSRH                                           281 - 311
//

Text Mined References (38)

PMID Year Title