Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 4.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy -1.416 2.4e-06
adult high grade glioma -1.100 1.2e-03
dermatomyositis -1.500 6.9e-04
group 3 medulloblastoma -1.100 3.0e-03
medulloblastoma, large-cell -1.300 7.3e-06
ovarian cancer 1.300 2.4e-05
psoriasis -1.100 6.2e-07

Synonym

Accession Q9NWW0 D3DUA7 Q68EN7
Symbols HPIP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQ      1 - 70
LSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL       71 - 138
//

Text Mined References (13)

PMID Year Title