Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 4.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 4.33302987243083E-6
medulloblastoma, large-cell 6234 7.27216641188313E-6
acute quadriplegic myopathy 1157 1.52509990272842E-5
ovarian cancer 8492 2.43257378856499E-5
psoriasis 6685 3.57977440931301E-5
dermatomyositis 967 6.87793191142919E-4
adult high grade glioma 2148 0.00119765457476592

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.900 0.000
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.300 0.000
acute quadriplegic myopathy -1.425 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.300 0.000
dermatomyositis -1.500 0.001

Synonym

Accession Q9NWW0 D3DUA7 Q68EN7
Symbols HPIP

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid

Gene RIF (5)

PMID Text
26463629 HPIP promotes thyroid cancer cell growth, migration and epithelial mesenchymal transformation through activating PI3K/AKT signaling pathway.
25800793 HPIP is upregulated in colorectal cancer and regulates colorectal cancer cell proliferation, apoptosis and invasion
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12235138 HPIP regulates HCF-1 activity by modulating its subcellular localization

AA Sequence

MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQ      1 - 70
LSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL       71 - 138
//

Text Mined References (12)

PMID Year Title
26463629 2015 HPIP promotes thyroid cancer cell growth, migration and EMT through activating PI3K/AKT signaling pathway.
25800793 2015 HPIP is upregulated in colorectal cancer and regulates colorectal cancer cell proliferation, apoptosis and invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...