Property Summary

NCBI Gene PubMed Count 9
Grant Count 13
R01 Count 13
Funding $1,011,677.45
PubMed Score 0.00
PubTator Score 4.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.900 0.000
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.300 0.000
acute quadriplegic myopathy -1.425 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.300 0.000
dermatomyositis -1.500 0.001

Gene RIF (5)

PMID Text
26463629 HPIP promotes thyroid cancer cell growth, migration and epithelial mesenchymal transformation through activating PI3K/AKT signaling pathway.
25800793 HPIP is upregulated in colorectal cancer and regulates colorectal cancer cell proliferation, apoptosis and invasion
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12235138 HPIP regulates HCF-1 activity by modulating its subcellular localization

AA Sequence

MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQ      1 - 70
LSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMEL       71 - 138
//

Text Mined References (12)

PMID Year Title
26463629 2015 HPIP promotes thyroid cancer cell growth, migration and EMT through activating PI3K/AKT signaling pathway.
25800793 2015 HPIP is upregulated in colorectal cancer and regulates colorectal cancer cell proliferation, apoptosis and invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...