Property Summary

NCBI Gene PubMed Count 29
Grant Count 10
R01 Count 10
Funding $943,803.43
PubMed Score 16.17
PubTator Score 9.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.084 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.100 0.000
ovarian cancer 1.700 0.000

Gene RIF (9)

PMID Text
24667604 MERIT40 interacts with ABRAXAS which is adaptor molecule of BRCA1-complex.
21431873 findings suggest that germline deleterious mutations in C19orf62 should be rare or absent in familial and nonfamilial breast cancer women
21282113 NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes
20852633 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852633 Single nucleotide polymorphism in MERIT40 is associated with ovarian cancer.
19572197 germline mutations in MERIT40 are rare or absent in familial breast cancer patients.
19261749 NBA1 is required to maintain BRE and Abra1 abundance and for the recruitment of BRCA1 to sites of DNA damage. In depth bioinformatics analysis revealed that the BRCA1 A complex bears striking similarities to the 19S proteasome complex.
19261748 A stable complex containing MERIT40 acts early in DNA damage response and regulates damage-dependent BRCA1 localization.
19261746 MERIT40 represents a novel factor that links BRCA1-Rap80 complex integrity, DSB recognition, and ubiquitin chain hydrolytic activities to the DNA damage response.

AA Sequence

MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP      1 - 70
KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK     71 - 140
SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV    141 - 210
VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY    211 - 280
EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV                         281 - 329
//

Publication (44)

PMID Year Title
26195665 2015 The deubiquitinating enzyme complex BRISC is required for proper mitotic spindle assembly in mammalian cells.
25416956 2014 A proteome-scale map of the human interactome network.
25283148 2014 ABRO1 suppresses tumourigenesis and regulates the DNA damage response by stabilizing p53.
24667604 2014 Role of MERIT40 in stabilization of BRCA1 complex: a protein-protein interaction study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...