Property Summary

NCBI Gene PubMed Count 30
PubMed Score 16.67
PubTator Score 9.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
medulloblastoma, large-cell 6241 1.6e-04
Multiple myeloma 1332 1.8e-04
lung cancer 4740 3.9e-04
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
ovarian cancer 8520 0.0 1.23673213612659E-5
Disease Target Count Z-score Confidence
Lupus nephritis 13 3.192 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
ovarian cancer 1.700 1.2e-05
lung cancer 1.100 3.9e-04
medulloblastoma, large-cell -1.100 1.6e-04
Multiple myeloma 1.084 1.8e-04

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP      1 - 70
KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK     71 - 140
SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV    141 - 210
VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY    211 - 280
EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV                         281 - 329
//

Text Mined References (45)

PMID Year Title