Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.21
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.3e-05
diabetes mellitus 1728 2.8e-03
Multiple myeloma 1332 8.7e-03
osteosarcoma 7950 1.4e-02
non primary Sjogren syndrome sicca 891 2.5e-02
lung cancer 4740 3.5e-02
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 3.037 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 2.8e-03
lung cancer 1.100 3.5e-02
Multiple myeloma 1.649 8.7e-03
non primary Sjogren syndrome sicca 1.200 2.5e-02
osteosarcoma -1.274 1.4e-02
ovarian cancer 1.700 2.3e-05

Gene RIF (2)

AA Sequence

MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHC      1 - 70
RRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST     71 - 140
SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL        141 - 206
//

Text Mined References (20)

PMID Year Title