Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.72
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 2.1e-03
ovarian cancer -1.200 4.8e-04
spina bifida -1.181 3.7e-02

Synonym

Accession Q9NWU2 E1P5I3 Q8N5M5
Symbols TWA1
C20orf11

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSVDLETLDERIKI      1 - 70
REMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECL     71 - 140
TEMERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKK    141 - 210
VKYPKMTDLSKGVIEEPK                                                        211 - 228
//

Text Mined References (13)

PMID Year Title