Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.18
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.99074112051141E-11
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00207468572071013
spina bifida 1064 0.0370305573886606
Disease Target Count Z-score Confidence
Lissencephaly 61 3.315 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 0.002
spina bifida -1.181 0.037
ovarian cancer 1.300 0.000

Synonym

Accession Q9NWU2 E1P5I3 Q8N5M5
Symbols TWA1
C20orf11

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

AA Sequence

MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSVDLETLDERIKI      1 - 70
REMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECL     71 - 140
TEMERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKK    141 - 210
VKYPKMTDLSKGVIEEPK                                                        211 - 228
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12559565 2003 A novel nuclear protein, Twa1, and Muskelin comprise a complex with RanBPM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...