Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1.93
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.400 0.000

Synonym

Accession Q9NWT8 Q5TA36 Q8TBD3 AURKA-interacting protein
Symbols AIP
AKIP
MRP-S38

Gene

PDB

3J9M  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (10)

PMID Text
22356826 Encodes a mitochondrial protein
21932983 Aurora-A protein increased in stomach cancer cells in response to cisplatin and was degraded upon combined treatment with capsaicin with cisplatin.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19221504 Aurora A is necessary for the maintenance of the mitotic delay induced in response to microtubule-perturbing agents.
18521620 Plk1 controls Aurora A localization and function by regulating cellular levels of hBora.
18391981 GSK-3beta modulates the early mitotic Aurora-A level through binding and phosphorylating AIP.
17957726 AKURA phosphorylation of AIP and stabilization of the enzyme-substrate complex are reported.
17452972 We propose that AURKAIP1 might function upstream of the Az1 by enhancing the binding affinity of Az1 to Aurora-A to promote recognition, targeting to proteasome and subsequent degradation.
15271856 Phe31Ile polymorphism in Aurora A may be a genetic modifier for developing breast carcinoma.
12244051 Results describe the identification of a novel negative regulator of Aurora-A, named AIP (Aurora-A kinase Interacting Protein).

AA Sequence

MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMS      1 - 70
VSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNH     71 - 140
HKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK               141 - 199
//

Publication (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23908630 2013 Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
21932983 2011 Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19221504 2009 The inhibition of Aurora A abrogates the mitotic delay induced by microtubule perturbing agents.
18521620 2008 Plk1 regulates mitotic Aurora A function through betaTrCP-dependent degradation of hBora.
18391981 2008 AIP regulates stability of Aurora-A at early mitotic phase coordinately with GSK-3beta.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17957726 2007 Aurora-A kinase phosphorylation of Aurora-A kinase interacting protein (AIP) and stabilization of the enzyme-substrate complex.
More...