Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 1.93
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.1e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.100 1.1e-05

Gene RIF (11)

AA Sequence

MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMS      1 - 70
VSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNH     71 - 140
HKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK               141 - 199
//

Text Mined References (24)

PMID Year Title