Property Summary

NCBI Gene PubMed Count 84
PubMed Score 75.11
PubTator Score 52.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Anemia of prematurity 1 3.053 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 5.0e-03
intraductal papillary-mucinous adenoma (... 1.400 2.7e-04
medulloblastoma, large-cell -1.100 4.7e-03
osteosarcoma -1.071 1.9e-04
ovarian cancer -1.700 8.4e-08
psoriasis -1.500 1.0e-03

Gene RIF (65)

AA Sequence

MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLV      1 - 70
YPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGG     71 - 140
EERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQI    141 - 210
KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHH    211 - 280
IESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN     281 - 349
//

Text Mined References (95)

PMID Year Title