Property Summary

NCBI Gene PubMed Count 75
Grant Count 11
R01 Count 8
Funding $1,486,203.66
PubMed Score 71.96
PubTator Score 52.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -2.144 0.000
medulloblastoma, large-cell -1.100 0.005
intraductal papillary-mucinous adenoma (... 1.400 0.000
diabetes mellitus -1.100 0.005
ovarian cancer -1.700 0.000

Gene RIF (59)

PMID Text
26752685 OTUB1 is a target for functional hydroxylation by FIH.
26205124 the levels of both miR-182 and HIF1alpha were elevated, while the expression PHD2 and FIH1 was downregulated in a mouse model of prostate cancer.
26112411 The kinetic properties of PHD2 and FIH with respect to oxygen reflect their cellular hypoxia-sensing ability.
25907805 demonstrates that miR-135b regulates ERalpha, AR and HIF1AN protein levels through interaction with their 3'UTR regions, and proliferation in ERalpha-positive BCa and AR-positive PCa cells
25837583 data support the concept that FIH-1 may interact with Notch2 and repress its activity, thereby playing a critical role in controlling the survival of vascular endothelial cells
25728779 miR-31/FIH1 pathway associates with liver fibrosis, perhaps by participation in the TGF-beta/Smad3 signalling of hepatic stellate cells.
25687434 the nuclear entry of FIH-1 depends on HIF-1alpha
25431923 The association between EGLN1 and HIF-1AN single nucleotide polymorphisms and acute mountain sickness in a Han Chinese population, was examined.
25423620 FIH follows the consensus mechanism for alphaKG oxygenases, suggesting that FIH may be an ideal enzyme to directly access steps involved in O2 activation among the broad family of alphaKG oxygenases.
25413349 Hypoxia, FIH inhibitors and mutation of asparagine 242 all potentiated TRPV3-mediated current, without altering TRPV3 protein levels, indicating that oxygen-dependent hydroxylation inhibits TRPV3 activity.
More...

AA Sequence

MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLV      1 - 70
YPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGG     71 - 140
EERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQI    141 - 210
KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHH    211 - 280
IESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN     281 - 349
//

Text Mined References (86)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26205124 2015 Hypoxia-inducible miR-182 enhances HIF1? signaling via targeting PHD2 and FIH1 in prostate cancer.
26112411 2015 Kinetic Investigations of the Role of Factor Inhibiting Hypoxia-inducible Factor (FIH) as an Oxygen Sensor.
25907805 2015 MicroRNA-135b regulates ER?, AR and HIF1AN and affects breast and prostate cancer cell growth.
25837583 2015 Factor-inhibiting HIF-1 (FIH-1) is required for human vascular endothelial cell survival.
25728779 2015 The role of the miR-31/FIH1 pathway in TGF-?-induced liver fibrosis.
25687434 2015 Featured Article: Hypoxia-inducible factor-1? dependent nuclear entry of factor inhibiting HIF-1.
25431923 2014 Variants of the low oxygen sensors EGLN1 and HIF-1AN associated with acute mountain sickness.
25423620 2014 The rate-limiting step of O2 activation in the ?-ketoglutarate oxygenase factor inhibiting hypoxia inducible factor.
More...