Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.28
PubTator Score 1.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 4 medulloblastoma 1855 1.0e-02

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma 1.100 1.0e-02

Gene RIF (1)

AA Sequence

MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLRELCCQWLQPEAHSKEQMLEMLV      1 - 70
LEQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVLKQEVLPAAQKTEEPLGSPHP     71 - 140
SGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPRIQE    141 - 210
EWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEA    211 - 280
QPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIH    281 - 350
HRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEECGCSFSWKSQLVIHRKSHTGQ    351 - 420
RRHFCSDCGRAFDWKSQLVIHRKGHRPEVP                                            421 - 450
//

Text Mined References (12)

PMID Year Title