Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.28
PubTator Score 1.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
group 4 medulloblastoma 1875 0.010005309934363
Disease Target Count Z-score Confidence
Hyperuricemia 35 3.025 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma 1.100 0.010

Synonym

Accession Q9NWS9
Symbols ZSCAN30
ZSCAN52
ZKSCAN20

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

PMID Text
15936718 Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE and AP-1.

AA Sequence

MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLRELCCQWLQPEAHSKEQMLEMLV      1 - 70
LEQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVLKQEVLPAAQKTEEPLGSPHP     71 - 140
SGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPRIQE    141 - 210
EWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEA    211 - 280
QPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIH    281 - 350
HRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEECGCSFSWKSQLVIHRKSHTGQ    351 - 420
RRHFCSDCGRAFDWKSQLVIHRKGHRPEVP                                            421 - 450
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15936718 2005 A novel human KRAB-containing zinc-finger gene ZNF446 inhibits transcriptional activities of SRE and AP-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.