Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.481 0.000
medulloblastoma 1.100 0.004
tuberculosis -1.600 0.004

Gene RIF (2)

PMID Text
19680542 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of family with sequence similarity 118, member A (FAM118A; C22orf8) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVIEAAEQLEVLH      1 - 70
PGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDDLEQHIRSPVVLQSILSLMDR     71 - 140
GAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYTDPCGVVLDPSGYKDV    141 - 210
TQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLL    211 - 280
HGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSD    281 - 350
TDDAGGS                                                                   351 - 357
//

Publication (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19680542 2009 Tissue effect on genetic control of transcript isoform variation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.