Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.09
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.9e-06
medulloblastoma 720 3.8e-03
tuberculosis 2010 3.8e-03

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma 1.100 3.8e-03
osteosarcoma -2.481 4.9e-06
tuberculosis -1.600 3.8e-03

Gene RIF (2)

AA Sequence

MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVIEAAEQLEVLH      1 - 70
PGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDDLEQHIRSPVVLQSILSLMDR     71 - 140
GAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYTDPCGVVLDPSGYKDV    141 - 210
TQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLL    211 - 280
HGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSD    281 - 350
TDDAGGS                                                                   351 - 357
//

Text Mined References (11)

PMID Year Title