Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.89051615809229E-6
medulloblastoma 1524 0.00375058316991579
tuberculosis 1563 0.00378316715789609

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.481 0.000
medulloblastoma 1.100 0.004
tuberculosis -1.600 0.004

Synonym

Accession Q9NWS6 B3KWG4 B4DY02 Q5TII5 Q96CY3
Symbols C22orf8

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
19680542 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of family with sequence similarity 118, member A (FAM118A; C22orf8) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVIEAAEQLEVLH      1 - 70
PGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDDLEQHIRSPVVLQSILSLMDR     71 - 140
GAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYTDPCGVVLDPSGYKDV    141 - 210
TQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLL    211 - 280
HGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSD    281 - 350
TDDAGGS                                                                   351 - 357
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19680542 2009 Tissue effect on genetic control of transcript isoform variation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.