Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.88
PubTator Score 1.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.577 1.9e-03
acute myeloid leukemia -3.000 3.4e-04
adult high grade glioma 2.000 2.5e-04
Astrocytoma, Pilocytic 1.700 4.9e-07
atypical teratoid/rhabdoid tumor 1.200 5.9e-04
ependymoma 1.800 3.0e-11
glioblastoma 1.700 8.4e-05
group 4 medulloblastoma -2.300 1.6e-04
interstitial cystitis 1.400 5.9e-04
intraductal papillary-mucinous carcinoma... 1.300 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-02
lung carcinoma -2.000 1.2e-20
malignant mesothelioma -1.900 7.1e-08
ovarian cancer -2.400 4.9e-06
primary pancreatic ductal adenocarcinoma 1.130 4.0e-04
primary Sjogren syndrome 2.000 2.9e-03
psoriasis 1.100 4.5e-04
subependymal giant cell astrocytoma 1.818 2.0e-02
ulcerative colitis 2.300 1.0e-09

Gene RIF (3)

AA Sequence

MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEITVIYRHGLPL      1 - 70
VTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINK     71 - 140
IAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIE    141 - 210
AHSEAKTSGLLWAGLALLSIQGGALAWLTWWVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVK    211 - 280
SRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN                  281 - 336
//

Text Mined References (11)

PMID Year Title