Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
R01 Count 2
Funding $165,156.5
PubMed Score 2.25
PubTator Score 1.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NWR8 A8K4Y3 Q6IAC1 MCUb
Symbols CCDC109B

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
24231807 MCUb (also known as CCDC109b) is a paralogue of MCU (CCDC109a). MCUb physically resides within the mitochondrial uniporter complex (uniplex), which consists of the MCU, MCUb, EMRE, MICU1, and MICU2.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEITVIYRHGLPL      1 - 70
VTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINK     71 - 140
IAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIE    141 - 210
AHSEAKTSGLLWAGLALLSIQGGALAWLTWWVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVK    211 - 280
SRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN                  281 - 336
//

Publication (11)

PMID Year Title
24231807 2013 EMRE is an essential component of the mitochondrial calcium uniporter complex.
23900286 2013 The mitochondrial calcium uniporter is a multimer that can include a dominant-negative pore-forming subunit.
23455636 2013 Seven new loci associated with age-related macular degeneration.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...