Property Summary

NCBI Gene PubMed Count 37
PubMed Score 50.10
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSV      1 - 70
TSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPES     71 - 140
AVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSAS    141 - 210
KELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAE    211 - 280
ESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQR    281 - 350
SPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI    351 - 420
SDLQQGRDITRL                                                              421 - 432
//

Text Mined References (40)

PMID Year Title