Property Summary

NCBI Gene PubMed Count 36
Grant Count 17
R01 Count 5
Funding $2,178,266.29
PubMed Score 48.34
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (22)

PMID Text
26211970 The risk-associated allele of rs2370615 predisposes to allergic disease by increasing PAG1 expression, which might promote B cell activation and have a pro-inflammatory effect.
26062415 Up-regulated expression of CBP in Jurkat cells could reduce cell homogeneity and promote cell apoptosis
25684946 CBP may decrease the metastasis of esophageal carcinoma by inhibiting the activation of Src.
25005592 No association Pag1 mutation with patient with Schizophrenia.
23671581 The inhibitory function of novobiocin in disrupting the HIF1alpha/p300 complex might be important in tumor cell growth.
22994656 siRNA directed against PAG1 in a radioresistant (Hep-2max) cell line dramatically enhanced the radiosensitivity and IR-induced cell death.
22659621 findings support a negative regulatory function for Cbp/PAG in proximal B cell receptor signaling in normal and EBV-transformed B cells
22027792 expression of CBP gene is decreased in esophageal carcinoma, which might contribute to the tumorigenesis and progression.
21388951 Cbp down-regulation is primarily mediated by epigenetic histone modifications via oncogenic MAPK/PI3K pathways in a subset of cancer cells.
21156787 Results indicate that Cbp is required for the Csk-mediated inactivation of c-Src and may control the promotion of malignancy in NSCLC tumors that are characterized by c-Src upregulation.
More...

AA Sequence

MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSV      1 - 70
TSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPES     71 - 140
AVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSAS    141 - 210
KELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAE    211 - 280
ESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQR    281 - 350
SPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI    351 - 420
SDLQQGRDITRL                                                              421 - 432
//

Text Mined References (39)

PMID Year Title
26211970 2015 Long-Range Modulation of PAG1 Expression by 8q21 Allergy Risk Variants.
26062415 2015 [Phenotypic changes and apoptosis of Jurkat cells induced by over-expression of C-Src kinase-binding protein].
25684946 2015 Overexpression of Csk-binding protein decreases growth, invasion, and migration of esophageal carcinoma cells by controlling Src activation.
25005592 2015 Sequencing and expression analyses of the synaptic lipid raft adapter gene PAG1 in schizophrenia.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23866081 2013 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23671581 2013 A novel function of novobiocin: disrupting the interaction of HIF 1? and p300/CBP through direct binding to the HIF1? C-terminal activation domain.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22994656 2012 Identification of the PAG1 gene as a novel target of inherent radioresistance in human laryngeal carcinoma cells.
22659621 2012 Modulation of proximal signaling in normal and transformed B cells by transmembrane adapter Cbp/PAG.
More...