Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease 1.400 4.6e-02
astrocytic glioma 1.700 3.5e-03
ependymoma 1.600 5.7e-03
gastric cancer 1.100 1.1e-02
non primary Sjogren syndrome sicca -1.100 1.6e-02
oligodendroglioma 1.600 3.2e-03
osteosarcoma 2.293 6.8e-06
pancreatic ductal adenocarcinoma liver m... 1.080 3.4e-02
Pick disease 1.100 1.7e-05
progressive supranuclear palsy -1.300 1.5e-02
tuberculosis -1.600 5.2e-08

Gene RIF (1)

AA Sequence

MDELVHDLASALEQTSEQNKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHTCCYSEASESSLD      1 - 70
EATKDCREVAPVTNFSDSDDTMVAKRHPALNAIVKSKQHSWHESDSFTENAPCRPLRRRRKVKRVTSEVA     71 - 140
ASLQQKLKVSDWSYERGCRFKSAKKQRLSRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQ    141 - 210
KQGSDENMSECETSSVCSSSDTGLFTNDEGRQGDDEQSDWFYEGECVPGFTVPNLLPKWAPDHCSEVERM    211 - 280
DSGLDKFSDSTFLLPSRPAQRGYHTRLNRLPGAAARCLRKGRRRLVGKETSINTLGTERISHIISDPRQK    281 - 350
EKNKALASDFPHISACAHEFNPLSPLYSLDVLADASHRRCSPAHCSARQANVHWGPPCSRDIKRKRKPVA    351 - 420
TASLSSPSAVHMDAVEPTTPASQAPKSPSSEWLVRTSAAEKATDATTATFFKMPQEKSPGYS            421 - 482
//

Text Mined References (18)

PMID Year Title