Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 5.19687529748566E-8
Pick disease 1893 2.95025352366766E-6
osteosarcoma 7933 6.79569087683611E-6
oligodendroglioma 2849 0.00322570378272667
astrocytic glioma 2241 0.00346845207759272
ependymoma 2514 0.00567503782217034
gastric cancer 436 0.0111155551536607
progressive supranuclear palsy 674 0.0150979833444778
non primary Sjogren syndrome sicca 840 0.0159483516987896
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0341252906377215
Alzheimer's disease 644 0.0462105221448539
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.100 0.011
astrocytic glioma 1.700 0.003
ependymoma 1.600 0.006
oligodendroglioma 1.600 0.003
osteosarcoma 2.293 0.000
pancreatic ductal adenocarcinoma liver m... 1.080 0.034
tuberculosis -1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.016
Alzheimer's disease 1.400 0.046
Pick disease 2.600 0.000
progressive supranuclear palsy -1.300 0.015

Synonym

Accession Q9NWQ4 B3KN42 Q6PEJ7 Q9H3M3 Q9NWH0 Q9ULR8
Symbols C14orf118

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDELVHDLASALEQTSEQNKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHTCCYSEASESSLD      1 - 70
EATKDCREVAPVTNFSDSDDTMVAKRHPALNAIVKSKQHSWHESDSFTENAPCRPLRRRRKVKRVTSEVA     71 - 140
ASLQQKLKVSDWSYERGCRFKSAKKQRLSRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQ    141 - 210
KQGSDENMSECETSSVCSSSDTGLFTNDEGRQGDDEQSDWFYEGECVPGFTVPNLLPKWAPDHCSEVERM    211 - 280
DSGLDKFSDSTFLLPSRPAQRGYHTRLNRLPGAAARCLRKGRRRLVGKETSINTLGTERISHIISDPRQK    281 - 350
EKNKALASDFPHISACAHEFNPLSPLYSLDVLADASHRRCSPAHCSARQANVHWGPPCSRDIKRKRKPVA    351 - 420
TASLSSPSAVHMDAVEPTTPASQAPKSPSSEWLVRTSAAEKATDATTATFFKMPQEKSPGYS            421 - 482
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...