Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-02
astrocytic glioma -1.400 1.1e-02
atypical teratoid / rhabdoid tumor -1.800 3.9e-07
ependymoma -1.500 2.3e-02
glioblastoma -1.100 3.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.4e-03
lung cancer -1.100 3.8e-04
medulloblastoma -1.200 6.6e-05
medulloblastoma, large-cell -1.700 2.1e-04
oligodendroglioma -1.100 3.1e-02
primitive neuroectodermal tumor -1.400 1.2e-04

AA Sequence

MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGKASSRKPFGILSPNVL      1 - 70
CSMSGKSPVESSLNVKTKKNAPSATIHQGEEEGPLDIWAVVKPGNTKEKIAFFASHQCSNRIGSMKIKSS     71 - 140
WDIDGRATKRRKKSGDLKKAKVQVERMREVNSRCYQPEPFACGIEHCSVHYVSDSGDGVYAGRPLSVIQM    141 - 210
VAFLEQRASALLASCSKNCTNSPAIVRFSGQSRGVPAVSESYSAPGACEEPTERGNLEVGEPQSEPVRVL    211 - 280
DMVAKLESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAPDTQVNPVGSVSVDC    281 - 350
GPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVEMTDELVGLPFSSHT    351 - 420
YSQASELPTDAVDCMSRELVSLTSRNPDQRKESLCISITVSKVDKDQPSILNSCEDPVPGMLFFLPPGQH    421 - 490
LSDYSQLNESTTKESSEASQLEDAAGGDSASEEKSGSAEPFVLPASSVESTLPVLEASSWKKQVSHDFLE    491 - 560
TRFKIQQLLEPQQYMAFLPHHIMVKIFRLLPTKSLVALKCTCCYFKFIIEYYNIRPADSRWVRDPRYRED    561 - 630
PCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYWMCCHRSQKGFPGCKLGLHDNHWVPACHSFNRAIHK    631 - 700
KAKGTEAEEEY                                                               701 - 711
//

Text Mined References (8)

PMID Year Title