Property Summary

NCBI Gene PubMed Count 19
PubMed Score 54.51
PubTator Score 13.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.009 9.4e-03
glioblastoma 1.400 8.8e-03
group 4 medulloblastoma -1.300 1.5e-03
lung cancer 1.200 3.9e-03
malignant mesothelioma -1.200 5.3e-06
medulloblastoma, large-cell -1.100 4.3e-03
non-small cell lung cancer 1.225 5.4e-13
osteosarcoma 3.811 1.4e-05
ovarian cancer -1.700 4.1e-07
Pick disease 1.100 9.4e-04
pituitary cancer -1.700 2.6e-09

Gene RIF (9)

AA Sequence

MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN      1 - 70
NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS     71 - 140
HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE    141 - 210
L//

Text Mined References (19)

PMID Year Title