Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.17
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.018 0.000
ependymoma 1.200 0.000
astrocytoma 1.100 0.043
atypical teratoid / rhabdoid tumor 1.100 0.001
primitive neuroectodermal tumor 1.200 0.000
hereditary spastic paraplegia 1.013 0.005
ovarian cancer 1.300 0.000

AA Sequence

MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPNMDYDIIECVL      1 - 70
RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEPDSSDEEPPPVYSPPAYHMHV     71 - 140
FDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGNLPDDFLRILPQQLDSIQGNAGGPKPGSGEG    141 - 210
CPPAMAGPGPGDQESRWKQYLEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGN    211 - 280
DFGFSSPVPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAA    281 - 350
STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ                                      351 - 386
//

Text Mined References (6)

PMID Year Title
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.