Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.17
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.018 0.000
ependymoma 1.200 0.000
astrocytoma 1.100 0.043
atypical teratoid / rhabdoid tumor 1.100 0.001
primitive neuroectodermal tumor 1.200 0.000
hereditary spastic paraplegia 1.013 0.005
ovarian cancer 1.300 0.000

AA Sequence

MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPNMDYDIIECVL      1 - 70
RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEPDSSDEEPPPVYSPPAYHMHV     71 - 140
FDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGNLPDDFLRILPQQLDSIQGNAGGPKPGSGEG    141 - 210
CPPAMAGPGPGDQESRWKQYLEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGN    211 - 280
DFGFSSPVPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAA    281 - 350
STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ                                      351 - 386
//

Publication (6)

PMID Year Title
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.