Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.17
PubTator Score 0.95

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 4.3e-02
atypical teratoid / rhabdoid tumor 1.100 7.7e-04
ependymoma 1.100 6.0e-06
hereditary spastic paraplegia 1.013 4.6e-03
osteosarcoma 2.018 7.7e-08
ovarian cancer 1.300 1.2e-04
primitive neuroectodermal tumor 1.200 2.8e-04

 Compartment GO Term (0)

AA Sequence

STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ                                      351 - 386

Text Mined References (6)

PMID Year Title