Property Summary

NCBI Gene PubMed Count 35
PubMed Score 1199.41
PubTator Score 104.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 4.4e-04
atypical teratoid / rhabdoid tumor -1.100 5.1e-05
ependymoma 1.100 9.6e-04
glioblastoma -1.100 1.4e-03
group 3 medulloblastoma -1.500 1.7e-04
malignant mesothelioma -1.500 8.8e-06
medulloblastoma, large-cell -1.300 3.4e-06
non primary Sjogren syndrome sicca 1.100 1.4e-02
oligodendroglioma 1.200 3.2e-02
osteosarcoma 1.141 2.7e-02
psoriasis 1.500 1.6e-08

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (20)

AA Sequence

MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHIGGRVQSVKLG      1 - 70
HATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFS     71 - 140
DLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESS    141 - 210
SHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEP    211 - 280
RGEGDHNHDTGEGGQGGEEPRGGRWDEDEQWSVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLP    281 - 350
TEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY    351 - 420
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSS    421 - 490
GADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGT         491 - 555
//

Text Mined References (37)

PMID Year Title