Property Summary

NCBI Gene PubMed Count 33
Grant Count 105
R01 Count 57
Funding $13,370,228.45
PubMed Score 1086.16
PubTator Score 104.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
oligodendroglioma 1.200 0.032
psoriasis 1.800 0.000
osteosarcoma 1.141 0.027
posterior fossa group B ependymoma 1.300 0.000
group 3 medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.014

Synonym

Accession Q9NWM0 A2A2P5 A2A2P6 A8BE87 D3DVZ4 Q5TE26 Q5TE27 Q6UY28 Q8IX00 Q96LC3 Q96LC4 Q96QT3 Q9BW38 Q9H6H1 Q9NP51 Q9NPY1 Q9NPY2
Symbols PAO
SMO
PAO1
PAOH
PAO-1
PAOH1
C20orf16

Gene

Gene RIF (18)

PMID Text
26895301 effect of Tat on Nrf2 activation in human neuroblastoma cells and the role of NMDA receptor and spermine oxidase on Tat-induced nuclear factor erythroid 2-related factor 2 (Nrf2) activation
25174398 During H. pylori infection, the enzyme spermine oxidase (SMOX) is induced, which generates hydrogen peroxide from the catabolism of the polyamine spermine, and increases gastric cancer risk.
24025154 study postulates a mechanism for SAT1 and SMOX down-regulation by post-transcriptional activity of miRNAs.
23665428 Tat was found to induce reactive oxygen species production and to affect cell viability in SH-SY5Y cells, these effects being mediated by spermine oxidase (SMO)
23665428 HIV-1 Tat-induced activation of spermine oxidase (SMO) activity involves NMDAR stimulation in human neuroblastoma
21839041 Spermine oxidase mediates the gastric cancer risk associated with Helicobacter pylori CagA.
21152090 each gene was associated with at least one main outcome: anxiety (SAT1, SMS), mood disorders (SAT1, SMOX), and suicide attempts (SAT1, OATL1).
20946629 Spermine oxidase (SMO) has a role in response to BENSpm and CPENSpm in breast tumor cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20127992 Increased expression of spermine oxidase is associated with ulcerative colitis.
More...

AA Sequence

MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHIGGRVQSVKLG      1 - 70
HATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFS     71 - 140
DLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESS    141 - 210
SHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEP    211 - 280
RGEGDHNHDTGEGGQGGEEPRGGRWDEDEQWSVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLP    281 - 350
TEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY    351 - 420
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSS    421 - 490
GADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGT         491 - 555
//

Publication (35)

PMID Year Title
26895301 2016 HIV-Tat Induces the Nrf2/ARE Pathway through NMDA Receptor-Elicited Spermine Oxidase Activation in Human Neuroblastoma Cells.
25174398 2015 Increased Helicobacter pylori-associated gastric cancer risk in the Andean region of Colombia is mediated by spermine oxidase.
24025154 2014 Regulatory role of miRNAs in polyamine gene expression in the prefrontal cortex of depressed suicide completers.
23665428 2013 A role for spermine oxidase as a mediator of reactive oxygen species production in HIV-Tat-induced neuronal toxicity.
21839041 2011 Spermine oxidase mediates the gastric cancer risk associated with Helicobacter pylori CagA.
21152090 2010 Association of polyaminergic loci with anxiety, mood disorders, and attempted suicide.
20946629 2010 Spermine oxidase (SMO) activity in breast tumor tissues and biochemical analysis of the anticancer spermine analogues BENSpm and CPENSpm.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20127992 2010 Increased expression and cellular localization of spermine oxidase in ulcerative colitis and relationship to disease activity.
More...