Property Summary

NCBI Gene PubMed Count 8
PubMed Score 36.77
PubTator Score 4.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.73734279805338E-14
posterior fossa group B ependymoma 1530 1.96354467200225E-10
pilocytic astrocytoma 3086 7.12108425555644E-9
ovarian cancer 8492 1.86305322032245E-6
glioblastoma 5572 7.93019698181953E-6
malignant mesothelioma 3163 1.55420353866182E-5
pediatric high grade glioma 2712 5.46624131071937E-5
atypical teratoid / rhabdoid tumor 4369 5.52455275099413E-5
invasive ductal carcinoma 2950 1.12757558012572E-4
interstitial cystitis 2299 0.0013443844938937
cutaneous lupus erythematosus 1056 0.00183064201256243
psoriasis 6685 0.00208934694415056
medulloblastoma, large-cell 6234 0.00903702922561698
chronic rhinosinusitis 512 0.0109777058375037
urothelial carcinoma 318 0.0266304189419193
cystic fibrosis and chronic rhinosinusitis 213 0.0374679886579328
primitive neuroectodermal tumor 3031 0.0410827062742616
Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 1.0
Disease Target Count Z-score Confidence
Alveolar echinococcosis 5 3.17 1.6

Expression

Synonym

Accession Q9NWH7 Q5T3N7 Q8WUE6
Symbols HASH
SRF1
SRF-1

Gene

  Ortholog (9)

 IMPC Term (1)

Pathway (1)

Gene RIF (1)

PMID Text
26464655 SPATA6 may play an important role in testicular germ cell tumors, and down-regulation of SPATA6 could lead to apoptosis of testicular germ cell tumors.

AA Sequence

MPKVKALQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVD      1 - 70
PGDVVTQLEYDTAVFELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPR     71 - 140
LEFSTTSVITECLISSRKCHTQDKFIYHLAPVEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPT    141 - 210
ISSKSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHVDPPSPRADTLLGSSGRDCE    211 - 280
RDGWSRVHNDHSHLGCCRPKDYKVIRTPHGRDFDDSLEKCEEYLSPRSCSKPRHSARTLLVHSAPSTMPK    281 - 350
HSPSPVLNRASLRERFHSDWCSPSNCDEIHDRVKNVLKSHQAHQRHLYDERDLEKDDELELKRSLLCRDS    351 - 420
AYDSDPEYSSCQQPRGTFHLDDGEYWSNRAASYKGKSHRPIFENSMDKMYRNLYKKACSSASHTQESF      421 - 488
//

Text Mined References (8)

PMID Year Title
26464655 2015 The role of spermatogenesis-associated protein 6 in testicular germ cell tumors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735130 2001 A novel spermatogenesis-related factor-1 gene expressed in maturing rat testis.