Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.67
PubTator Score 13.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 0.001

Synonym

Accession Q9NWF4 B5MEV1 B5MEV2 Q6P9E0 Q86UT0
Symbols PAR2
RFT1
RBFVD
RFVT1
hRFT1
GPCR42
GPR172B

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25284511 results are the first to reveal the identity of the minimal SLC52A1 promoter and to establish an important role for Sp-1 in its activity
24139842 data suggest that MMND is a distinct clinical subgroup of childhood onset MND patients where the known genetic defects are so far negative.
23506902 summary of recent findings on the cloning, nomenclature, functional characterization and genetic diseases of RFVT1/SLC52A1, RFVT2/SLC52A2 and RFVT3/SLC52A3 [review]
23413253 Intestinal riboflavin uptake process undergoes differentiation-dependent upregulation and suggest that this is mediated (at least in part) via transcriptional mechanisms of SLC52A1 and SLC52A3.
22702469 We demonstrated that TFAP-2gamma is one of the transcription factors involved in the PAR-2 expression in human villous trophoblast cells.
18632736 Identification/characterization riboflavin trasporter (RFT1) as a novel riboflavin transporter.

AA Sequence

MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRQ      1 - 70
LAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLP     71 - 140
PPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAA    141 - 210
FRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGA    211 - 280
FLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGM    281 - 350
LFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSL    351 - 420
LGAGAMFPPTSIYHVFQSRKDCVDPCGP                                              421 - 448
//

Text Mined References (15)

PMID Year Title
25284511 2014 Identification and characterization of 5'-flanking region of the human riboflavin transporter 1 gene (SLC52A1).
24139842 2013 Madras motor neuron disease (MMND) is distinct from the riboflavin transporter genetic defects that cause Brown-Vialetto-Van Laere syndrome.
23506902 Novel riboflavin transporter family RFVT/SLC52: identification, nomenclature, functional characterization and genetic diseases of RFVT/SLC52.
23413253 2013 Differentiation-dependent regulation of intestinal vitamin B(2) uptake: studies utilizing human-derived intestinal epithelial Caco-2 cells and native rat intestine.
22702469 Binding of transcription factor activating protein 2 ? on the 5'-proximal promoter region of human porcine endogenous retrovirus subgroup A receptor 2/GPR172B.
21089064 2011 Maternal riboflavin deficiency, resulting in transient neonatal-onset glutaric aciduria Type 2, is caused by a microdeletion in the riboflavin transporter gene GPR172B.
20463145 2010 Identification and comparative functional characterization of a new human riboflavin transporter hRFT3 expressed in the brain.
18632736 2008 Identification and functional characterization of a novel human and rat riboflavin transporter, RFT1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...