Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.845 0.000
psoriasis 1.200 0.003
glioblastoma 2.000 0.000
osteosarcoma -1.683 0.000
ependymoma 1.300 0.000
astrocytoma 1.200 0.045
intraductal papillary-mucinous adenoma (... 1.100 0.007
pediatric high grade glioma 1.400 0.000
ovarian cancer 2.000 0.000

AA Sequence

MFSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLLRFNDLDLCVS      1 - 70
ENETLKHLTNDTTTPESTMTSGQARASTQSPQALEDSGPVNISVSITLTLDPLKPFGGYSRNVTHLYSTI     71 - 140
LGHQIGLSGREAHEEINITFTLPTAWSSDDCALHGHCEQVVFTACMTLTASPGVFPVTVQPPHCVPDTYS    141 - 210
NATLWYKIFTTARDANTKYAQDYNPFWCYKGAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVM    211 - 280
VITMFCYAVIKGRPSKLRQSNPEFCPEKVALAEA                                        281 - 314
//

Publication (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.