Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 2.2106095486283E-13
Multiple myeloma 1328 6.72501011421312E-6
pediatric high grade glioma 2712 7.58175030435568E-6
osteosarcoma 7933 1.34255290059415E-5
ovarian cancer 8492 1.55652208025014E-4
glioblastoma 5572 3.67128808020916E-4
psoriasis 6685 0.00297538565621558
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00708756232859476
astrocytoma 1493 0.0448732271942618
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.845 0.000
psoriasis 1.200 0.003
glioblastoma 2.000 0.000
osteosarcoma -1.683 0.000
ependymoma 1.300 0.000
astrocytoma 1.200 0.045
intraductal papillary-mucinous adenoma (... 1.100 0.007
pediatric high grade glioma 1.400 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q9NWD8 Q53H07 Q96FR2
Symbols C7orf42

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

AA Sequence

MFSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLLRFNDLDLCVS      1 - 70
ENETLKHLTNDTTTPESTMTSGQARASTQSPQALEDSGPVNISVSITLTLDPLKPFGGYSRNVTHLYSTI     71 - 140
LGHQIGLSGREAHEEINITFTLPTAWSSDDCALHGHCEQVVFTACMTLTASPGVFPVTVQPPHCVPDTYS    141 - 210
NATLWYKIFTTARDANTKYAQDYNPFWCYKGAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVM    211 - 280
VITMFCYAVIKGRPSKLRQSNPEFCPEKVALAEA                                        281 - 314
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.