Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.98
PubTator Score 6.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.671 2.0e-02
active ulcerative colitis 3.267 1.5e-02
acute quadriplegic myopathy 1.321 3.2e-06
adult high grade glioma 2.900 7.3e-05
astrocytoma 1.600 3.4e-13
Astrocytoma, Pilocytic 3.000 7.7e-09
atypical teratoid / rhabdoid tumor 1.800 2.9e-03
chronic rhinosinusitis 1.740 3.2e-02
cystic fibrosis and chronic rhinosinusit... 2.434 1.4e-02
ductal carcinoma in situ 2.500 8.4e-03
ependymoma 1.500 4.1e-03
glioblastoma 3.200 1.7e-09
invasive ductal carcinoma 1.115 5.9e-03
lung cancer 1.300 3.0e-02
medulloblastoma 1.600 1.1e-02
Multiple myeloma 1.883 2.9e-02
non-small cell lung cancer 1.357 1.5e-07
oligodendroglioma 2.000 4.5e-13
osteosarcoma 1.339 2.5e-02
ovarian cancer -2.500 1.2e-03
pancreatic cancer 2.100 9.9e-04
pancreatic carcinoma 2.100 9.9e-04
pituitary cancer -4.100 6.3e-06
primitive neuroectodermal tumor 2.000 1.2e-03
severe asthma -1.100 2.7e-04

Synonym

Accession Q9NWC5 Q53YW5
Symbols DERP7
DNAPTP4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGMALTGMAGEQF      1 - 70
IPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPVSLTKLMLSNALFVEAFIFYN     71 - 140
HTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLELLRSSLILLQGSWFFQIGFVLYPPSGGPAW    141 - 210
DLMDHENILFLTICFCWHYAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM         211 - 275
//

Text Mined References (8)

PMID Year Title