Property Summary

NCBI Gene PubMed Count 8
Grant Count 14
Funding $2,122,727.03
PubMed Score 20.62
PubTator Score 6.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26722455 our study suggests that TMEM45A may work as an oncogene and a new effective therapeutic target for glioma treatment.
25872785 knockdown of TMEM45A also inhibited cell adhesion as well as cell invasion. More importantly, suppression of TMEM45A notably downregulated the expression of TGF-b1, TGF-b2, RhoA and ROCK2.
24689342 TMEM45A expression is correlated to epidermal keratinization
22954140 Data suggest that high levels of TMEM45A expression in tumors may be indicative of potential resistance to cancer therapy, making TMEM45A an interesting biomarker for resistance.

AA Sequence

MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGMALTGMAGEQF      1 - 70
IPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPVSLTKLMLSNALFVEAFIFYN     71 - 140
HTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLELLRSSLILLQGSWFFQIGFVLYPPSGGPAW    141 - 210
DLMDHENILFLTICFCWHYAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM         211 - 275
//

Text Mined References (8)

PMID Year Title
26722455 2015 Knockdown of TMEM45A inhibits the proliferation, migration and invasion of glioma cells.
25872785 2015 Inhibition of TMEM45A suppresses proliferation, induces cell cycle arrest and reduces cell invasion in human ovarian cancer cells.
24689342 2014 High TMEM45A expression is correlated to epidermal keratinization.
22954140 2012 TMEM45A is essential for hypoxia-induced chemoresistance in breast and liver cancer cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.