Property Summary

NCBI Gene PubMed Count 17
PubMed Score 23.78
PubTator Score 11.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.400 2.7e-26
chronic rhinosinusitis -1.550 4.1e-02
cystic fibrosis and chronic rhinosinusit... -1.152 4.8e-02
diabetes mellitus -1.400 1.9e-03
ependymoma 1.100 7.7e-07
glioblastoma 1.200 6.9e-03
lung adenocarcinoma -1.100 3.4e-09
lung cancer -1.100 6.1e-03
lung carcinoma -1.100 9.3e-13
malignant mesothelioma -2.300 1.6e-08
Multiple myeloma 1.720 6.0e-03
non-small cell lung cancer -1.323 1.9e-18
osteosarcoma 1.307 8.2e-03
pancreatic ductal adenocarcinoma liver m... 1.399 4.3e-02

 GO Function (1)

Gene RIF (10)

AA Sequence

MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPS      1 - 70
RHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY     71 - 140
GEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNV    141 - 210
LKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALK    211 - 280
ETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVM    281 - 350
EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV    351 - 420
IPEPATGFY                                                                 421 - 429
//

Text Mined References (22)

PMID Year Title