Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.81
PubTator Score 11.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.24209357780033E-37
Breast cancer 3099 2.7396266392237E-26
lung carcinoma 2844 9.32805597571394E-13
lung adenocarcinoma 2714 3.40087372136813E-9
posterior fossa group B ependymoma 1530 6.41569634770073E-9
malignant mesothelioma 3163 1.59715688587992E-8
osteosarcoma 7933 6.44329761342563E-8
diabetes mellitus 1663 0.00185041570487972
Multiple myeloma 1328 0.00602780416537471
lung cancer 4473 0.00614322743681687
glioblastoma 5572 0.00694675380590837
chronic rhinosinusitis 512 0.0414838811405971
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0434803322845742
cystic fibrosis and chronic rhinosinusitis 213 0.0475185868746402
Disease Target Count Z-score Confidence
Huntington's disease 72 4.421 2.2
Ellis-Van Creveld syndrome 19 3.438 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.720 0.006
malignant mesothelioma -2.300 0.000
osteosarcoma -2.277 0.000
posterior fossa group B ependymoma 1.800 0.000
glioblastoma 1.200 0.007
pancreatic ductal adenocarcinoma liver m... 1.399 0.043
non-small cell lung cancer -2.370 0.000
lung cancer -1.100 0.006
diabetes mellitus -1.400 0.002
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.100 0.000
Breast cancer -1.400 0.000
chronic rhinosinusitis -1.550 0.041
cystic fibrosis and chronic rhinosinusit... -1.152 0.048

Synonym

Accession Q9NWB7 Q96DA9
Symbols HIPPI
MHS4R2
ESRRBL1

Gene

PANTHER Protein Class (1)

  Ortholog (11)

 GO Function (1)

Gene RIF (9)

PMID Text
21943362 HIPPI-P53 interaction was necessary for HIPPI mediated up-regulation of Caspase1 gene.
21832040 novel transcription regulatory mechanism of REST by HIPPI may contribute to the deregulation of transcription observed in the cell model of Huntington disease.
18188704 Over-expression of BLOC1S2 in presence or absence of HIPPI does not induce apoptosis. However, BLOC1S2 & HIPPI sensitize NCH89 glioblastoma cells to pro-apoptotic actions of staurosporine & death ligand TRAIL.
17173859 In summary, we showed that HIPPI could interact with the putative promoter sequence of caspase-1 and increased the expression of the downstream gene suggesting that HIPPI could act as transcription regulator.
17142908 Crystals of the pDED of HIPPI were grown in space group P4(1), with unit-cell parameters a = b = 77.42, c = 33.31 A and a calculated Matthews coefficient of 1.88 A3 Da(-1) (33% solvent content) with two molecules per asymmetric unit.
16364650 Hippi expression induced apoptosis by releasing AIF and cytochrome c from mitochondria, activation of caspase-1 and caspase-3, and altering the expression of apoptotic genes and genes involved in mitochondrial complex I and II.
12745083 Hippi interacts with the viral death protein Apoptin.
11807533 critical for the death-promoting effects of mutant huntingtin protein in cultured cells
11788820 Results show that pro-apoptotic Hippi-Hip-1 heterodimers can recruit procaspase-8 into a complex of Hippi, Hip-1 and procaspase-8, and launch apoptosis through components of the 'extrinsic' cell-death pathway.

AA Sequence

MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPS      1 - 70
RHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY     71 - 140
GEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNV    141 - 210
LKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALK    211 - 280
ETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVM    281 - 350
EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV    351 - 420
IPEPATGFY                                                                 421 - 429
//

Text Mined References (19)

PMID Year Title
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
21943362 2011 Genome wide gene expression regulation by HIP1 Protein Interactor, HIPPI: prediction and validation.
21832040 2011 Regulation of RE1 protein silencing transcription factor (REST) expression by HIP1 protein interactor (HIPPI).
18188704 2008 BLOC1S2 interacts with the HIPPI protein and sensitizes NCH89 glioblastoma cells to apoptosis.
17623017 2007 Interactions of HIPPI, a molecular partner of Huntingtin interacting protein HIP1, with the specific motif present at the putative promoter sequence of the caspase-1, caspase-8 and caspase-10 genes.
17173859 2007 Interaction of HIPPI with putative promoter sequence of caspase-1 in vitro and in vivo.
17142908 2006 Cloning, expression, purification, crystallization and preliminary crystallographic analysis of pseudo death-effector domain of HIPPI, a molecular partner of Huntingtin-interacting protein HIP-1.
17107665 2007 Homer1c interacts with Hippi and protects striatal neurons from apoptosis.
16364650 2006 Induction of apoptosis in cells expressing exogenous Hippi, a molecular partner of huntingtin-interacting protein Hip1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...