Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.60
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.85710833153297E-25
Breast cancer 3099 3.8464143977032E-21
ovarian cancer 8492 3.56444065473005E-7
Pick disease 1893 1.40755406599256E-6
glioblastoma 5572 8.0242099757518E-6
medulloblastoma, large-cell 6234 1.27134580672716E-5
atypical teratoid / rhabdoid tumor 4369 1.33322111702213E-5
ependymoma 2514 1.35430420602824E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.595951078899E-4
pediatric high grade glioma 2712 3.65682411800449E-4
osteosarcoma 7933 4.94563127763766E-4
pilocytic astrocytoma 3086 0.0012624202912148
invasive ductal carcinoma 2950 0.0028392354605114
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0069799563223457
progressive supranuclear palsy 674 0.00786444456341553
hereditary spastic paraplegia 313 0.0132549561821536
oligodendroglioma 2849 0.0135236164584846
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0138870513527601
astrocytic glioma 2241 0.030063018427639
pancreatic ductal adenocarcinoma liver metastasis 1795 0.034298012577924
Alzheimer's disease 644 0.0355995806044256
subependymal giant cell astrocytoma 2287 0.0386175624837663
Disease Target Count Z-score Confidence
Crescentic glomerulonephritis 1 3.915 2.0

Expression

Synonym

Accession Q9NWB6 B4E0Y3 Q5T257 Q6IQ34
Symbols

Gene

  Ortholog (13)

Gene RIF (2)

PMID Text
21454576 establish ARGLU1 as a new MED1-interacting protein required for estrogen-dependent gene transcription and breast cancer cell growth.
18187620 Knockdown of arginine and glutamate rich 1 (ARGLU1; FLJ 10154) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRER      1 - 70
DRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAK     71 - 140
RVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNR    141 - 210
KIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD           211 - 273
//

Text Mined References (17)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21454576 2011 Arginine and glutamate-rich 1 (ARGLU1) interacts with mediator subunit 1 (MED1) and is required for estrogen receptor-mediated gene transcription and breast cancer cell growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...