Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.70
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (2)

AA Sequence

MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRER      1 - 70
DRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAK     71 - 140
RVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNR    141 - 210
KIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD           211 - 273
//

Text Mined References (17)

PMID Year Title