Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.76
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH      1 - 70
NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM     71 - 140
FEIPKE                                                                    141 - 146
//

Text Mined References (11)

PMID Year Title