Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.76
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NWA0
Symbols MED25

Gene

Gene RIF (1)

PMID Text
14638676 the FLJ10193 protein, which we designate Med25, is a bona fide subunit of the mammalian Mediator complex

AA Sequence

MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH      1 - 70
NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM     71 - 140
FEIPKE                                                                    141 - 146
//

Text Mined References (11)

PMID Year Title
24952135 2014 RNA-Seq for the identification of novel Mediator transcripts in endothelial progenitor cells.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...