Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.55
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.7e-05
invasive ductal carcinoma 2951 1.8e-04
interstitial cystitis 2312 2.6e-04
cystic fibrosis 1696 2.8e-04
group 4 medulloblastoma 1855 4.6e-03
Disease Target Count Z-score Confidence
Scoliosis 44 3.028 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 1.241 2.8e-04
group 4 medulloblastoma -1.100 4.6e-03
interstitial cystitis -1.100 2.6e-04
invasive ductal carcinoma 1.200 1.8e-04
tuberculosis -1.600 1.7e-05

Synonym

Accession Q9NW97 A8K819
Symbols C1orf72

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV      1 - 70
GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT     71 - 140
NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK    141 - 210
LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD                               211 - 253
//

Text Mined References (11)

PMID Year Title