Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.251 0.001
non primary Sjogren syndrome sicca 1.300 0.022
ovarian cancer 1.600 0.000

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEK      1 - 70
NRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEG     71 - 140
LDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLP    141 - 210
AVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA                           211 - 257
//

Publication (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065704 2013 A meta-analysis of genome-wide association studies to identify prostate cancer susceptibility loci associated with aggressive and non-aggressive disease.
21682944 2012 DOCK4 and CEACAM21 as novel schizophrenia candidate genes in the Jewish population.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...