Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.57
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-05
osteosarcoma 7950 6.6e-04
non primary Sjogren syndrome sicca 891 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 2.2e-02
osteosarcoma -1.251 6.6e-04
ovarian cancer 1.600 4.4e-05

Gene RIF (1)

AA Sequence

MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEK      1 - 70
NRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEG     71 - 140
LDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLP    141 - 210
AVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA                           211 - 257
//

Text Mined References (13)

PMID Year Title