Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.89
PubTator Score 2.50

Knowledge Summary


No data available



Accession Q9NW75 Q5VYK7 Q5VYK8 Q86YE7
Symbols CT110


PANTHER Protein Class (1)

Gene RIF (3)

25376275 GPATC2 may be involved in inhibiting G1-S phase transition in 293T cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19432882 Involvement of GPATCH2 overexpression in breast carcinogensis is reported.

AA Sequence

KGISEPIQAMQRPKGLGLGFPLPKSTSATTTPNAGKSA                                    491 - 528

Publication (17)

PMID Year Title
25376275 2015 G-patch domain containing 2, a gene highly expressed in testes, inhibits nuclear factor-?B and cell proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19432882 2009 Involvement of G-patch domain containing 2 overexpression in breast carcinogenesis.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.