Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.89
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NW75 Q5VYK7 Q5VYK8 Q86YE7
Symbols Pfa1
CT110
GPATC2
PPP1R30

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCPLKRQARKRRG      1 - 70
RKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKR     71 - 140
PLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVK    141 - 210
KRKLKIIRQGPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGD    211 - 280
DEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHG    281 - 350
MSSKNIKKSGGTPTSMVPIPGPVGNKRMVHFSPDSHHHDHWFSPGARTEHDQHQLLRDNRAERGHKKNCS    351 - 420
VRTASRQTSMHLGSLCTGDIKRRRKAAPLPGPTTAGFVGENAQPILENNIGNRMLQNMGWTPGSGLGRDG    421 - 490
KGISEPIQAMQRPKGLGLGFPLPKSTSATTTPNAGKSA                                    491 - 528
//

Text Mined References (18)

PMID Year Title