Property Summary

NCBI Gene PubMed Count 43
PubMed Score 286.21
PubTator Score 45.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
substance-related disorder 162 0.0 1.1
Disease Target Count Z-score Confidence
Cleft Lip 141 3.739 1.9
Cancer 2499 3.558 1.8
Mutism 17 3.204 1.6

Expression

  Differential Expression (9)

Gene RIF (21)

AA Sequence

MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIV      1 - 70
QQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKA     71 - 140
EDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEK    141 - 210
TWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSV    211 - 280
LQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQ    281 - 350
SFNIIFGECPYCSKPITLKMSGRKH                                                 351 - 375
//

Text Mined References (44)

PMID Year Title