Property Summary

NCBI Gene PubMed Count 41
Grant Count 108
R01 Count 29
Funding $16,937,888.73
PubMed Score 275.19
PubTator Score 45.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NW38 Q6GU60
Symbols POG
PHF9
FAAP43

Gene

PANTHER Protein Class (2)

PDB

3ZQS   4CCG  

Gene RIF (20)

PMID Text
26385482 Using small interfering RNA (siRNA), knockdown of FANCF, FANCL, or FANCD2 inhibited function of the FA/BRCA pathway in A549, A549/DDP and SK-MES-1 cells, and potentiated sensitivity of the three cells to cisplatin.
25754594 Loss-of-Function FANCL Mutations Associate with Severe Fanconi Anemia Overlapping the VACTERL Association
23783032 a signal transduction pathway involved in self-renewal and survival of hematopoietic stem cells also functions to stabilize FANCL and suggesting that FANCL participates directly in support of stem cell function.
22828653 FAVL elevation can increase the tumorigenic potential of bladder cancer cells, including the invasive potential that confers the development of advanced bladder cancer.
22653977 Suppression of FANCL expression in normal CD34(+) stem and progenitor cells results in fewer beta-catenin active cells and inhibits expansion of multilineage progenitors.
21697891 FA DNA repair genes, FANCD2, FANCL, and FANCC, are transcriptionally upregulated differently in melanoma compared with non-melanoma skin cancer
21543111 genetic diversity in FANCA, FANCC and FANCL does not support an association of these genes with cervical cancer susceptibility in the Swedish population.
21297076 FANCL is associated with acute lung injury in mice
20407210 expression of a novel splice variant of FA complementation group L (FANCL), named FAVL, can impair the FA pathway in non-FA tumor cells and act as a tumor promoting factor
19737859 results rule out a major role of FANCL in familial breast cancer susceptibility
More...

AA Sequence

MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIV      1 - 70
QQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKA     71 - 140
EDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEK    141 - 210
TWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSV    211 - 280
LQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQ    281 - 350
SFNIIFGECPYCSKPITLKMSGRKH                                                 351 - 375
//

Text Mined References (42)

PMID Year Title
26385482 2015 RNA interferences targeting the Fanconi anemia/BRCA pathway upstream genes reverse cisplatin resistance in drug-resistant lung cancer cells.
25754594 2015 Loss-of-Function FANCL Mutations Associate with Severe Fanconi Anemia Overlapping the VACTERL Association.
25416956 2014 A proteome-scale map of the human interactome network.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23783032 2013 The PI3K/Akt1 pathway enhances steady-state levels of FANCL.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22828653 2012 FAVL impairment of the Fanconi anemia pathway promotes the development of human bladder cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22653977 2012 FANCL ubiquitinates ?-catenin and enhances its nuclear function.
More...