Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
Funding $620,347
PubMed Score 73.22
PubTator Score 6.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.200 0.013
glioblastoma multiforme 1.300 0.000
oligodendroglioma 1.100 0.000
osteosarcoma -1.212 0.000
group 3 medulloblastoma 1.300 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.100 0.000
acute quadriplegic myopathy 1.192 0.000
lung cancer 2.200 0.000
colon cancer 1.100 0.002
Breast cancer -2.300 0.029
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.300 0.000

Gene RIF (5)

PMID Text
25939713 RBM28 controls the expression of miR-203. RBM28 contributes to hair follicle growth regulation through modulation of miR-203 and p63 activity.
22944692 Positional proteomics analysis identifies the cleavage of human RNA binding motif protein 28 (RBM28) at amino acid residues 648-649 by the HIV-1 protease
20231366 RBM28 gene defects should be added to the growing list of gene defects associated with syndromic combined anterior pituitary hormone deficiency.
18439547 A loss-of-function mutation is found in RBM28, encoding a nucleolar protein in patients with alopecia, progressive neurological defects, and endocrinopathy (ANE syndrome).
17081119 RBM28 is a common nucleolar component of the spliceosomal ribonucleoprotein complexes, possibly coordinating their transition through the nucleolus

AA Sequence

MAGLTLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEITTFEG      1 - 70
CKINVTVAKKKLRNKTKEKGKNENSECPKKEPKAKKAKVADKKARLIIRNLSFKCSEDDLKTVFAQFGAV     71 - 140
LEVNIPRKPDGKMRGFGFVQFKNLLEAGKALKGMNMKEIKGRTVAVDWAVAKDKYKDTQSVSAIGEEKSH    141 - 210
ESKHQESVKKKGREEEDMEEEENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKS    211 - 280
SDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE    281 - 350
LGELLQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVTR    351 - 420
DEAAKLQTTKVKKPTGTRNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQNIFVSRTRLC    421 - 490
LHNLPKAVDDKQLRKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLI    491 - 560
NNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQKAAQHHTEE    561 - 630
QSKVPPEQKRKAGSTSWTGFQTKAEVEQVELPDGKKRRKVLALPSHRGPKIRLRDKGKVKPVHPKKPKPQ    631 - 700
INQWKQEKQQLSSEQVSRKKAKGNKTETRFNQLVEQYKQKLLGPSKGAPLAKRSKWFDS               701 - 759
//

Text Mined References (23)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25939713 2015 RBM28, a protein deficient in ANE syndrome, regulates hair follicle growth via miR-203 and p63.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20231366 2010 ANE syndrome caused by mutated RBM28 gene: a novel etiology of combined pituitary hormone deficiency.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18439547 2008 Alopecia, neurological defects, and endocrinopathy syndrome caused by decreased expression of RBM28, a nucleolar protein associated with ribosome biogenesis.
More...