Property Summary

NCBI Gene PubMed Count 18
PubMed Score 82.57
PubTator Score 6.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.192 2.7e-08
adult high grade glioma 1.100 6.9e-05
astrocytic glioma 1.200 1.3e-02
atypical teratoid / rhabdoid tumor 1.200 2.6e-06
Breast cancer -2.300 2.9e-02
colon cancer 1.100 1.8e-03
glioblastoma 1.300 7.2e-07
group 3 medulloblastoma 1.300 1.9e-04
lung cancer 2.200 1.0e-04
medulloblastoma, large-cell 1.100 3.9e-04
oligodendroglioma 1.100 8.3e-18
osteosarcoma -1.212 2.8e-05
ovarian cancer 1.300 4.5e-05

Gene RIF (6)

AA Sequence

MAGLTLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEITTFEG      1 - 70
CKINVTVAKKKLRNKTKEKGKNENSECPKKEPKAKKAKVADKKARLIIRNLSFKCSEDDLKTVFAQFGAV     71 - 140
LEVNIPRKPDGKMRGFGFVQFKNLLEAGKALKGMNMKEIKGRTVAVDWAVAKDKYKDTQSVSAIGEEKSH    141 - 210
ESKHQESVKKKGREEEDMEEEENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKS    211 - 280
SDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE    281 - 350
LGELLQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVTR    351 - 420
DEAAKLQTTKVKKPTGTRNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQNIFVSRTRLC    421 - 490
LHNLPKAVDDKQLRKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLI    491 - 560
NNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQKAAQHHTEE    561 - 630
QSKVPPEQKRKAGSTSWTGFQTKAEVEQVELPDGKKRRKVLALPSHRGPKIRLRDKGKVKPVHPKKPKPQ    631 - 700
INQWKQEKQQLSSEQVSRKKAKGNKTETRFNQLVEQYKQKLLGPSKGAPLAKRSKWFDS               701 - 759
//

Text Mined References (25)

PMID Year Title