Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.26
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 6.33704270969924E-25
posterior fossa group A ependymoma 1511 6.64691050232242E-15
ovarian cancer 8492 4.53555145850583E-10
pilocytic astrocytoma 3086 1.80574609263699E-7
pediatric high grade glioma 2712 6.58112163565022E-6
glioblastoma 5572 8.70761912568044E-4
astrocytoma 1493 0.00183319168867245
dermatomyositis 967 0.00256036892244926
subependymal giant cell astrocytoma 2287 0.00750386321885453

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.600 0.002
glioblastoma 1.500 0.001
posterior fossa group A ependymoma 1.600 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.407 0.008
lung carcinoma -1.100 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.100 0.003

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
14555962 Describes identification and characterization of rat NECAP1 and NECAP2 and their roles in endocytosis.

AA Sequence

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ      1 - 70
APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ     71 - 140
NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG    141 - 210
GSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF                     211 - 263
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...