Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.27
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 4.9e-04
astrocytoma 1.200 6.8e-21
Astrocytoma, Pilocytic 1.200 2.3e-07
dermatomyositis 1.100 2.6e-03
ependymoma 1.500 7.5e-16
glioblastoma 1.500 8.7e-04
lung carcinoma -1.100 6.3e-25
ovarian cancer -1.500 4.5e-10
subependymal giant cell astrocytoma 1.407 7.5e-03

Gene RIF (2)

AA Sequence

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ      1 - 70
APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ     71 - 140
NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG    141 - 210
GSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF                     211 - 263
//

Text Mined References (20)

PMID Year Title