Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.26
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.600 0.002
glioblastoma 1.500 0.001
posterior fossa group A ependymoma 1.600 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.407 0.008
lung carcinoma -1.100 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.100 0.003

Gene RIF (1)

PMID Text
14555962 Describes identification and characterization of rat NECAP1 and NECAP2 and their roles in endocytosis.

AA Sequence

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ      1 - 70
APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ     71 - 140
NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG    141 - 210
GSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF                     211 - 263
//

Publication (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...