Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.1e-06
ovarian cancer 8520 1.4e-05
osteosarcoma 7950 1.0e-04
group 3 medulloblastoma 4104 1.9e-02
lung cancer 4740 2.1e-02
subependymal giant cell astrocytoma 2287 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.100 4.1e-06
group 3 medulloblastoma 1.200 1.9e-02
lung cancer 1.100 2.1e-02
osteosarcoma -1.237 1.0e-04
ovarian cancer -1.500 1.4e-05
subependymal giant cell astrocytoma -1.227 3.6e-02

Synonym

Accession Q9NVX7 D3DQS1 D3DQS2 Q6IA85 Q9BUC3 Q9NV76
Symbols BKLHD4
HSPC252

Gene

PDB

2EQX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQLHRLVLSAQSCFF      1 - 70
RSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIYHGTVKLRAEELQEIYEVSDMYQLTSLFEECSRFLAR     71 - 140
TVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIE    141 - 210
AWINFNKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCHQITAA    211 - 280
CKHGGDLYVVGGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTLSNAVIY    281 - 350
YRVGDNVWTETTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTKPSRLIQCFDTETDKCHVKPYVLPFA    351 - 420
GRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCLPEAWSSAPSLWKIASCNGSIYVFRDRYKKGDANT    421 - 490
YKLDPATSAVTVTRGIKVLLTNLQFVLA                                              491 - 518
//

Text Mined References (7)

PMID Year Title