Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma -1.559 0.007
astrocytic glioma 1.800 0.012
ependymoma 2.000 0.010
oligodendroglioma 1.900 0.006
psoriasis 1.200 0.001
osteosarcoma 2.167 0.000
pancreatic ductal adenocarcinoma liver m... 2.006 0.005
Pick disease 1.200 0.000
acute myeloid leukemia 2.200 0.048
ovarian cancer -1.200 0.000

Synonym

Accession Q9NVX0 C9JH36 Q9H9B3
Symbols CEP27
C15orf25
HsT17025

Gene

AA Sequence

MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELL      1 - 70
KLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAV     71 - 140
TFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESY    141 - 210
LYKHDIIMPPLPFTSKVHVQTINAK                                                 211 - 235
//

Text Mined References (17)

PMID Year Title
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
18443220 2008 Augmin: a protein complex required for centrosome-independent microtubule generation within the spindle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...