Property Summary

NCBI Gene PubMed Count 17
Grant Count 11
R01 Count 8
Funding $1,838,233
PubMed Score 36.27
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.100 0.001
primary pancreatic ductal adenocarcinoma 1.156 0.007
tuberculosis -1.100 0.000
diabetes mellitus -1.200 0.003
pediatric high grade glioma 1.100 0.001
ulcerative colitis 1.300 0.000
ovarian cancer 1.400 0.000
pancreatic cancer 1.500 0.001

Gene RIF (9)

PMID Text
26926424 RNF12 is a novel positive regulator of p53 pathway and an external E3 ubiquitin ligase for MDM2 destruction.
25735484 missense mutation in RLIM gene was identified in four males with intellectual disability from a three-generation family.
24686088 Rlim is a novel regulator of Stathmin protein in a ubiquitin-dependent manner, and represents a new pathway for malignant phenotype turnover by modulating the level of Stathmin protein in human osteosarcomas.
23904271 hus regulated nucleocytoplasmic shuttling of RLIM/Rnf12 coordinates cellular compartments during mammary alveolar cell survival
23650532 TP53 does not directly bind to the RLIM promoter, it physically interacts with and prevents the binding of Sp1 to the RLIM promoter.
21945933 these results indicated that RLIM is an important positive regulator in TGF-beta signaling pathway and cell migration.
19945382 These findings provide evidence for a dose-dependent role of RNF12 in the XCI counting and initiation process.
19164295 RLIM represents a new pathway for telomere maintenance by modulating the level of TRF1 at telomeres.
12874135 Functional analysis of the Xenopus homolog

AA Sequence

MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQ      1 - 70
IKEGPPPQNSDENRGGDSSDDVSNGDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLE     71 - 140
INVNRNNGSQNSENENEPSARRSSGENVENNSQRQVENPRSESTSARPSRSERNSTEALTEVPPTRGQRR    141 - 210
ARSRSPDHRRTRARAERSRSPLHPMSEIPRRSHHSISSQTFEHPLVNETEGSSRTRHHVTLRQQISGPEL    211 - 280
LSRGLFAASGTRNASQGAGSSDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTP    281 - 350
NNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFM    351 - 420
YSDSDSEPTGSVSNRNMERAESRSGRGGSGGGSSSGSSSSSSSSSSSSSSSSSSSSPSSSSGGESSETSS    421 - 490
DLFEGSNEGSSSSGSSGARREGRHRAPVTFDESGSLPFLSLAQFFLLNEDDDDQPRGLTKEQIDNLAMRS    491 - 560
FGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRESVV          561 - 624
//

Publication (24)

PMID Year Title
26926424 2016 RNF12 promotes p53-dependent cell growth suppression and apoptosis by targeting MDM2 for destruction.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25735484 2015 Syndromic X-linked intellectual disability segregating with a missense variant in RLIM.
24686088 2014 Rlim, an E3 ubiquitin ligase, influences the stability of Stathmin protein in human osteosarcoma cells.
23904271 2013 Functional activity of RLIM/Rnf12 is regulated by phosphorylation-dependent nucleocytoplasmic shuttling.
23650532 2013 p53 Represses transcription of RING finger LIM domain-binding protein RLIM through Sp1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21945933 2011 RLIM interacts with Smurf2 and promotes TGF-? induced U2OS cell migration.
19945382 2009 RNF12 is an X-Encoded dose-dependent activator of X chromosome inactivation.
More...