Property Summary

NCBI Gene PubMed Count 17
PubMed Score 39.19
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus -1.200 2.8e-03
glioblastoma 1.100 1.4e-03
ovarian cancer 1.400 7.9e-05
pancreatic cancer 1.500 7.6e-04
pediatric high grade glioma 1.100 6.5e-04
primary pancreatic ductal adenocarcinoma 1.156 6.9e-03
tuberculosis -1.100 1.8e-05
ulcerative colitis 1.300 1.6e-05

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQ      1 - 70
IKEGPPPQNSDENRGGDSSDDVSNGDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLE     71 - 140
INVNRNNGSQNSENENEPSARRSSGENVENNSQRQVENPRSESTSARPSRSERNSTEALTEVPPTRGQRR    141 - 210
ARSRSPDHRRTRARAERSRSPLHPMSEIPRRSHHSISSQTFEHPLVNETEGSSRTRHHVTLRQQISGPEL    211 - 280
LSRGLFAASGTRNASQGAGSSDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTP    281 - 350
NNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFM    351 - 420
YSDSDSEPTGSVSNRNMERAESRSGRGGSGGGSSSGSSSSSSSSSSSSSSSSSSSSPSSSSGGESSETSS    421 - 490
DLFEGSNEGSSSSGSSGARREGRHRAPVTFDESGSLPFLSLAQFFLLNEDDDDQPRGLTKEQIDNLAMRS    491 - 560
FGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRESVV          561 - 624
//

Text Mined References (25)

PMID Year Title